DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG6431

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001188790.1 Gene:CG6431 / 34476 FlyBaseID:FBgn0032289 Length:351 Species:Drosophila melanogaster


Alignment Length:300 Identity:85/300 - (28%)
Similarity:130/300 - (43%) Gaps:45/300 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 LHTLVPQDNANRQTGPLKSEKESPHRRLFQQVVGNTLTAAFGLNVMN----------KGDQEQNQ 139
            |.:|.|..||::.           ||...|.::.|   ..|.||.:|          |...:. |
  Fly    15 LLSLNPITNASKY-----------HREALQFLLRN---GNFDLNPLNCHILLWETCPKRFIDY-Q 64

  Fly   140 QFTSE------PVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNI 198
            .|||.      |:|:.:..:|.:..||....|..:|||:.|.........|..||.   :.::|:
  Fly    65 LFTSNGPRRGTPLNVKNPITLYKGGFSKHRETVFIIHGFNGTAIDIHLQFLRDAYL---SRDFNV 126

  Fly   199 FTVDW-GRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHL 262
            .|||| .......|:.:....:...|..|:...||.....:| |.:..||.|:|||:.|:...||
  Fly   127 ITVDWRPLTRYPCYLHSLINTRLTAQCTAQIYAFLTHYGAVR-ERITCVGHSLGAHICGMISNHL 190

  Fly   263 QTGRLRMIRALDPALPFF-RYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQ 326
            ...:.|:| .||||.|.. |....|.||:.:||:.::||||:.|..|.:...||:::..|.|..|
  Fly   191 TRKQYRII-GLDPARPLIERMKSNKFRLSIDDANVIQVLHTNAGFLGQEDNSGHLNYCVNGGRIQ 254

  Fly   327 PGCFWH-----ECSHWRAFMLFAESLARDQATGFLSQGCP 361
            |.|..:     .|||:.:....|.:..:...  |:...||
  Fly   255 PFCKGNPIRKSRCSHFLSICYLATATFKHNK--FMGVPCP 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 70/236 (30%)
CG6431NP_001188790.1 Abhydrolase 63..293 CDD:304388 70/237 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.