DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG7367

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_609175.2 Gene:CG7367 / 34094 FlyBaseID:FBgn0031976 Length:389 Species:Drosophila melanogaster


Alignment Length:305 Identity:96/305 - (31%)
Similarity:151/305 - (49%) Gaps:37/305 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 FGLNVMNKGD---QEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLP 186
            :|.:..:..|   .|.|.:|...  :..|.......:|:|...|:||:|||..:..:|....:..
  Fly   100 YGSDSSSSADFWIDENNFEFPQR--HKRDTWQEMAEKFNPELDTKILVHGWKSSTMSNSIQSIRG 162

  Fly   187 AYFDLRNGNYNIFTVDWGRGAIAD---YIT-ASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVG 247
            ||  :..|..|:|.::|...  ||   |:| |.|.|: ||:.:||.:|.|.:|.......:.|:|
  Fly   163 AY--IERGQVNVFAINWKDQ--ADNIYYLTPARYTVQ-VGRAVAKLIDLLVEEKDADPNRIHLIG 222

  Fly   248 FSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFR-YAKPKERLTAEDADYVEVLHTSVGSYGFDR 311
            .|:|||:.|.||.:.:. |:..|..||||.|.|. ...|:..|...||::|:|:|:..|..||.:
  Fly   223 HSLGAHIMGYAGSYTKY-RVNRITGLDPARPAFEDCIGPENHLDDTDANFVDVIHSCAGYLGFRK 286

  Fly   312 PVGHVDFYANWGS-QQPGC-----FWHECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTR 370
            |:|.||||.|.|. .||||     .:..|||.|::..:|||:  :...||  .|.|.:...:| :
  Fly   287 PIGMVDFYPNGGGPPQPGCKELSQIFTGCSHGRSYEYYAESI--NSPKGF--YGVPCSGLDEL-K 346

  Fly   371 FHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPYVL 415
            ...|   ||....||..:..       :.:|:::.:|.::|.|.|
  Fly   347 GKNC---TGGKILMGDPVPR-------EARGIFFVKTANKPSYAL 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 90/281 (32%)
CG7367NP_609175.2 Pancreat_lipase_like 115..374 CDD:238363 89/281 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445975
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.