DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG18641

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_608682.3 Gene:CG18641 / 33429 FlyBaseID:FBgn0031426 Length:369 Species:Drosophila melanogaster


Alignment Length:379 Identity:104/379 - (27%)
Similarity:163/379 - (43%) Gaps:70/379 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LQPDYKLLYSAEHHTYFHLHTLVPQDNA----------NRQT------GPLKSEKESPHRRLFQQ 115
            ::.|:.|.......|.|||.....| ||          ..||      ..|:.....||.::   
  Fly    10 IRADFWLQLLCVSFTLFHLEFAAAQ-NAGVVAAAVAAGQNQTQVYVTDSCLQKPYRCPHPKI--- 70

  Fly   116 VVGNTLTAAFGLNVMNKGDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANM 180
                      ...:..:..|||     .|.:::.|..:|..:.|:|.:||:|:|||:.|....:.
  Fly    71 ----------QFYLYTRRTQEQ-----PEFIDVLDPNALYYTHFNPRHPTKIIIHGFGGGRTLSP 120

  Fly   181 YNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQV-LAKFVDFL-HQEAGMRFEDL 243
            ..:|..|||.:  |.|||..||:........::........|.: :::.|.:| ....|::.:||
  Fly   121 SPDLREAYFSV--GEYNIIIVDYADAVKEPCLSQMDWAPRFGSLCISQLVKYLARHPRGVQPDDL 183

  Fly   244 QLVGFSMGAHVAGLAGKHL--QTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGS 306
            ..:|:|:|||:|||...:|  :.|:|..|.||||.:.|:..|.....|.:.||.:|:||||..|.
  Fly   184 HFIGYSVGAHIAGLVANYLKPEEGKLGRITALDPTIFFYAGANNSRDLDSTDAHFVDVLHTGAGI 248

  Fly   307 YGFDRPVGHVDFYANWGSQQPGCFWH-------ECSHWRAFMLFAESLARDQATGFLSQGCP--- 361
            .|.....||.|||.|.|::||.|...       .|.|.:....|.||:...:  ||.:..||   
  Fly   249 LGQWHSSGHADFYVNGGTRQPACVGSATLFQTLACDHTKVTPYFIESITTTR--GFYAGPCPNLF 311

  Fly   362 --AAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413
              ...|.:       |||:..: .||...::       :.:|.||..||.:.|:
  Fly   312 SYLIGWCE-------PKDSEYV-LMGEHCSH-------KARGNYYVTTNAKAPF 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 85/286 (30%)
CG18641NP_608682.3 Pancreat_lipase_like 68..346 CDD:238363 88/314 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.