DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG4267

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001259919.1 Gene:CG4267 / 33405 FlyBaseID:FBgn0264979 Length:374 Species:Drosophila melanogaster


Alignment Length:279 Identity:97/279 - (34%)
Similarity:143/279 - (51%) Gaps:30/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 DAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLR----NG------NYNIFTVDWG 204
            |..:||.|.|...:.|||:||||:.....:...::..||..|.    ||      ::|:...||.
  Fly    92 DVENLRNSGFDARHQTRIVIHGWMSQSKGSHIRKVKNAYLSLTDPGPNGEPAPYEDFNVIVCDWS 156

  Fly   205 RGAI-ADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLR 268
            :.:. .:|...:..|:.:|.:||:.|.:|:|||.|.::|:.::|.|:||.:||.|||.:...|..
  Fly   157 KTSTNVNYYEVAKTVEDMGALLAELVRYLNQEANMHYDDVYVIGHSLGAQIAGSAGKQIMPYRFN 221

  Fly   269 MIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGCFWHE 333
            .|.|||||.|.||....:.|:.|.||.|||.:.||| |:||::||||..||.|:|..|..|:.:.
  Fly   222 TIYALDPAGPQFREKSDEYRIDASDASYVESIQTSV-SFGFEQPVGHATFYPNYGKNQKKCYVYG 285

  Fly   334 CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPK-DTGV-MQTMGGDLANVSAEFL 396
            |||.|:...|.|||.           .||..|..     ||.: |.|. :..|......:..|..
  Fly   286 CSHKRSHDYFIESLT-----------SPAGFWGP-----RCERHDDGTWLLLMSDGEFRMGGEPS 334

  Fly   397 AQRQGVYYFQTNDQPPYVL 415
            ..:.|.:|.:|..:|||.:
  Fly   335 IPKNGTFYVKTYSKPPYAM 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 94/271 (35%)
CG4267NP_001259919.1 Lipase 64..351 CDD:278576 95/275 (35%)
Pancreat_lipase_like 71..347 CDD:238363 94/271 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438409
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000679
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.