DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and pla1a

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_996939.1 Gene:pla1a / 334017 ZFINID:ZDB-GENE-030131-5949 Length:456 Species:Danio rerio


Alignment Length:302 Identity:87/302 - (28%)
Similarity:137/302 - (45%) Gaps:53/302 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 FSPFNPTRILIHGW--LGNENANMYNELLPAYFD------LRNGNYNIFTVDWGRGAIADYITAS 215
            |:...||::::||:  ||::         |::..      ||..:.|:..|||..||...|....
Zfish    81 FNSSLPTKVIVHGYRALGSK---------PSWVSGLAQALLREEDVNVLVVDWVYGASFAYNLVV 136

  Fly   216 YRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFF 280
            ...|.|...::..::.| .:.|...|....:|.|:||||:|..|. |..|:|..|..||||.|.|
Zfish   137 ENYKEVAVQISVLINQL-TKYGSTLESFHFIGVSLGAHVSGFVGT-LFHGKLGRITGLDPAGPMF 199

  Fly   281 RYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQPGCF---------WHECSH 336
            :.|.|.:||.:.||.:||.:||....:|...|||||||:.|.|..|.||.         :..|.|
Zfish   200 KSADPFDRLDSSDALFVEAIHTDSDYFGISIPVGHVDFFLNGGMDQAGCARSRFASMYGYVICDH 264

  Fly   337 WRAFMLFAESLARD------QATG---FLSQGCPAAEWQQLTRFH-RCPKDTGVMQTMGGDLANV 391
            .||..::..:|...      ..:|   ||:..|...:    ..|: .||: .|:::..|     :
Zfish   265 MRALHVYMSALNGSCPLIGFPCSGYEEFLAGKCITCD----DPFNGTCPQ-IGLLKNSG-----I 319

  Fly   392 SAEFLAQRQGVYYFQTNDQP---PYVLAQNASSK--RAAHIQ 428
            :|..|..::.||...|...|   .::|.:...|:  :.|.:|
Zfish   320 TATPLPNQEKVYLLTTASGPFCAHHILVELNVSRLDKTAEVQ 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 82/276 (30%)
pla1aNP_996939.1 Lipase 21..340 CDD:278576 82/279 (29%)
Pancreat_lipase_like 48..336 CDD:238363 81/275 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578503
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.