DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG5162

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001285367.1 Gene:CG5162 / 32709 FlyBaseID:FBgn0030828 Length:411 Species:Drosophila melanogaster


Alignment Length:336 Identity:91/336 - (27%)
Similarity:149/336 - (44%) Gaps:56/336 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 QQVVGNTLTAAFG--LNVMN----KGDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGW 172
            |.:..|.:.:.:.  :|.||    ...:::|...|| |.:::     :...|.......||..||
  Fly    82 QALASNKIKSKYSPDINKMNFQLQTACEKKNFPLTS-PESMW-----KSPLFDVKKKVVILATGW 140

  Fly   173 LGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLA----KFVDFLH 233
            ....|.:...|:....::.| |:.|...||..|.....|..:::..:.:|:.:|    |.:|.  
  Fly   141 TTTVNGSDTIEVFSKAYNCR-GDVNFVAVDAARFVDTLYTWSAFNTEEIGENIALGLVKLLDL-- 202

  Fly   234 QEAGMRFEDLQLVGFSMGAHVAGLAGKHLQ---TGRLRMIRALDPALPFFRYAKPKERLTAEDAD 295
                :..|::.|:|.|:|||:.|.||:|||   ...:..|..||||.|.|...:....|...||.
  Fly   203 ----VPVENIHLIGHSLGAHIVGSAGRHLQHLTNQTIPRITGLDPAKPCFNEGEALSGLMRGDAH 263

  Fly   296 YVEVLHTSVGSYGFDRPVGHVDFYANWGSQQP---GCFWHECSHWRAFMLFAESLARDQATGFLS 357
            :|:|:|::.|..|...|||.||||.  |...|   |||...|:|.|::..|||::.......|::
  Fly   264 FVDVIHSNPGVLGKRDPVGDVDFYP--GGMSPLAAGCFSVTCAHARSWEYFAETVFPGNERNFMA 326

  Fly   358 QGCPAAEWQQLTRFHRCPKDT-----GVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPYVLAQ 417
            ..|.:.  .:|..| |||.|.     .|.|.:.|:               |:.:.:...|:  ..
  Fly   327 TRCNSI--SKLRDF-RCPGDEVPMGYAVPQNIKGN---------------YFLEVSASAPF--GM 371

  Fly   418 NASSKRAAHIQ 428
            :||..|:||::
  Fly   372 HASVVRSAHLE 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 80/285 (28%)
CG5162NP_001285367.1 Lipase 94..369 CDD:278576 83/307 (27%)
Pancreat_lipase_like 99..365 CDD:238363 82/298 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446084
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.