DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG18258

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_573201.1 Gene:CG18258 / 32708 FlyBaseID:FBgn0265267 Length:468 Species:Drosophila melanogaster


Alignment Length:379 Identity:100/379 - (26%)
Similarity:150/379 - (39%) Gaps:79/379 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 NRQTG-----------PLKSEKESPHRRLFQQ----VVGNTLTAAFG-LN--------------- 128
            |..||           |..|.:|:...||..|    |||..|...|. ||               
  Fly   100 NTMTGLDDSESLKLARPASSYQEALLNRLQDQLNQFVVGLPLDLGFSTLNYICSTIVDLGVVRSK 164

  Fly   129 ----------VMNKGDQEQNQQFTSEPV----NLYDAASLRRSRFSPFNPTRILIHGWLGNENAN 179
                      ::...|..||   ||.|:    .|::.....:.|     ||.:.|.||..:.|.:
  Fly   165 LIPDMSRMSFLLRSSDDCQN---TSIPLTQAEQLWNTTGFYQDR-----PTVLFITGWTTSINNS 221

  Fly   180 MYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQ 244
            ....:..||  |...:.|:..:|........|..::...:.:|..|||.:  |........:...
  Fly   222 NSGPVAKAY--LCRNDTNVLILDAANFIDTLYTWSALNTEVIGDYLAKAL--LRLNTSYVTKQFH 282

  Fly   245 LVGFSMGAHVAGLAGKH---LQTGR-LRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVG 305
            |||.|:||.:||.||::   |..|: |:.|..||||.|.|......|.|.:.||.:|:::||:.|
  Fly   283 LVGHSLGAQIAGSAGRNYRRLSGGQILKRITGLDPANPCFYDGNELEGLRSGDARFVDIIHTNPG 347

  Fly   306 SYGFDRPVGHVDFYANWGSQ-QPGCFWHE---CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQ 366
            .:|..:..|..||:...... :|||...:   |||.||...:.|::.......||::.|  ..:.
  Fly   348 MFGTSKRAGDADFFVQGRIPFKPGCESLDPISCSHQRAVDYWTETVYPSNGNDFLAKRC--KRYS 410

  Fly   367 QLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPYVLAQNAS 420
            :|...:.|.....||    |..|.      |...|::|...|.:.||  .|||:
  Fly   411 ELLLGNYCKNTNTVM----GYAAK------ATDLGLFYVGANPEEPY--GQNAN 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 76/282 (27%)
CG18258NP_573201.1 Pancreat_lipase_like 172..443 CDD:238363 78/294 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446085
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.