DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Lipi

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_011244435.1 Gene:Lipi / 320355 MGIID:2443868 Length:485 Species:Mus musculus


Alignment Length:240 Identity:77/240 - (32%)
Similarity:114/240 - (47%) Gaps:42/240 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 SEPVNLYDAASLRRSRFSPFNPTRILIHG---------WLGNENANMYNELLPAYFDLRNGNYNI 198
            :||  |:::.:...:||:|...|..:|||         ||        :....|:  |:..:.|:
Mouse    72 AEP--LFESNNSLNTRFNPAKKTVWIIHGYRPFGSTPVWL--------SRFTKAF--LKQEDVNL 124

  Fly   199 FTVDWGRGAIA-DYITASYRVKPVGQVLAKFVD--FLHQEAGMRFEDLQLVGFSMGAHVAGLAGK 260
            ..|||.:||.. .|..|....:.|.::|.:.::  .:|   |...::...:|.|:|||::|..||
Mouse   125 IVVDWNQGATTFMYSRAVRNTRRVAEILRETIENLLIH---GASLDNFHFIGMSLGAHISGFVGK 186

  Fly   261 --HLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWG 323
              |.|.||   |..||||.|.|.......||...||.:|:|:||.:.|.|...|.||:|||.|.|
Mouse   187 IFHGQLGR---ITGLDPAGPQFSRKPSNSRLYYTDAKFVDVIHTDIKSLGIGEPSGHIDFYPNGG 248

  Fly   324 SQQPGC--------FWHECSHWRAFMLFAESLARDQATGFLSQGC 360
            ..||||        .:.:|.|.||..||.  .|.:.:..|:|..|
Mouse   249 KHQPGCPTSIFSGTNFIKCDHQRAIYLFL--AAFETSCNFVSFPC 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 77/240 (32%)
LipiXP_011244435.1 Pancreat_lipase_like 57..346 CDD:238363 77/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835397
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.