DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and CG5966

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_572286.1 Gene:CG5966 / 31532 FlyBaseID:FBgn0029831 Length:540 Species:Drosophila melanogaster


Alignment Length:411 Identity:104/411 - (25%)
Similarity:164/411 - (39%) Gaps:101/411 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LLYSAEHHTYFHLHTLV-----PQDNANRQ-----------TGPLKSEKESPHRRLFQQVVGNTL 121
            :||.|.|.:...::|||     |:.:.|..           .||                 .||:
  Fly    15 MLYLANHTSRAAVNTLVDLPPAPKSDINEVKCFGVYGCFPINGP-----------------WNTV 62

  Fly   122 TAAFGLNVMNKGDQEQNQQFT-------SEP--VNLYDAASLRRSRFSPFNPTRILIHGWLGNEN 177
            |.:  :||..:...|....||       .:|  ::|.|..|::....:|.....:|:||:|.:..
  Fly    63 TRS--INVHPQKPSEIEPHFTLHTRRALDQPKYLDLNDPESVQGMGMNPKGKIFLLVHGYLESGE 125

  Fly   178 ANMYNELLPAYFDLR--------NGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQ 234
                   :|..:|:.        .|..::..:|||.||...|:.|...::.||.:.|..|..|::
  Fly   126 -------IPWMWDMAKALLAHEPEGRASVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYE 183

  Fly   235 EAGM-RFEDLQLVGFSMGAHVAGLAGKHLQTG---RLRMIRALDPALPFFRYAKPKERLTAEDAD 295
            |..: ..:::.::|.|:|||::|.||.|||..   :...|..||||.|.|....|..||...||.
  Fly   184 ELRLPNLDNVHIIGHSLGAHLSGYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAH 248

  Fly   296 YVEVLHTSV-----GSYGFDRPVGHVDFYANWGSQQPGC------------------FWHECSHW 337
            :|:::||..     |..|.:..:|||||:.|.|...|||                  .:..|:|.
  Fly   249 FVDIVHTDANPLMKGGLGINMRLGHVDFFPNGGFDNPGCNKKFQDVVKKKTLFLTMQEFLGCNHI 313

  Fly   338 RAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMG----------GDLANVS 392
            |:...|.||:.  ....||...|.:.|..:.|:...|.:.......||          .||..:.
  Fly   314 RSQQYFTESIG--SQCPFLGITCDSFESFKDTKCTSCEEPGHTCLRMGYHSQEDYQEQVDLGQLQ 376

  Fly   393 AEFLAQRQGVYYFQTNDQPPY 413
            .   ....||:|..|.|..|:
  Fly   377 Q---GDSPGVFYLWTGDSKPF 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 85/324 (26%)
CG5966NP_572286.1 Lipase 46..394 CDD:278576 94/378 (25%)
Pancreat_lipase_like 76..390 CDD:238363 85/325 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.