DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Lipi

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_001099369.1 Gene:Lipi / 288322 RGDID:1310162 Length:476 Species:Rattus norvegicus


Alignment Length:328 Identity:93/328 - (28%)
Similarity:147/328 - (44%) Gaps:62/328 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 QNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTV 201
            :|....:||  |:::.:...:||:|...|..:|||:....:..|:.......| |:..:.|:..|
  Rat    66 RNNAKCAEP--LFESNNSVNARFNPSKKTIWIIHGYRPLGSTPMWIHKFTKAF-LKQEDVNLIVV 127

  Fly   202 DWGRGAIA-DYITASYRVKPVGQVLAKFVD--FLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQ 263
            ||.:||.. .|..|....:.|.::|.::::  .:|   |...::...:|.|:|||:.|..||..|
  Rat   128 DWNQGATTFIYGRAVKNTRKVAEILREYIENLLIH---GASLDNFHFIGMSLGAHICGFVGKLFQ 189

  Fly   264 TGRLRMIRALDPALPFFRYAKPKE-RLTAEDADYVEVLHTSVGSYGFDRPVGHVDFYANWGSQQP 327
             |:|..|..||||.|.|. .||.. ||...||.:|:|:|:....:|...|.||:|||.|.|..||
  Rat   190 -GQLGRITGLDPAGPKFS-GKPSNCRLDYTDAKFVDVIHSDSQGFGILEPSGHIDFYPNGGRNQP 252

  Fly   328 GC--------FWHECSHWRAFMLFAESLA-------------RDQATGFLSQGCPAAEWQQLTRF 371
            ||        .:.:|.|.||..||.|:..             ||..:| |..||     ..|.: 
  Rat   253 GCPTSLLSGMDYIKCDHQRAVHLFLEAFETNCNFVSFPCRSYRDYKSG-LCVGC-----GNLYK- 310

  Fly   372 HRCPKDTGVMQTMGGDLANVSAEFLAQR------QGVYYFQTNDQPPY--------VLAQNASSK 422
            ..||: .|:.       ||:..|.|.::      :...:..|:.|.|:        ::|.|.:.|
  Rat   311 DSCPR-LGIQ-------ANLWKEELKKKTEEWPLRTTAFLDTSSQNPFCTYYFALNIVALNETMK 367

  Fly   423 RAA 425
            ..:
  Rat   368 NGS 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 88/301 (29%)
LipiNP_001099369.1 Pancreat_lipase_like 57..346 CDD:238363 88/302 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339009
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.