DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Pnlip

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_037293.2 Gene:Pnlip / 25702 RGDID:3360 Length:465 Species:Rattus norvegicus


Alignment Length:272 Identity:81/272 - (29%)
Similarity:125/272 - (45%) Gaps:55/272 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 DQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNI 198
            :|:..|:.||      ||:|:|.|.|.....|||:|||::.....|..:::....|.:.  :.|.
  Rat    62 NQDNYQKITS------DASSIRNSNFKTNRKTRIIIHGFIDKGEENWLSDMCKNMFKVE--SVNC 118

  Fly   199 FTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQ 263
            ..|||..|:.|.|..|:..|:.||..:|..|:.|..:.|...:::.|:|.|:|:||||.|||. .
  Rat   119 ICVDWKGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGYSPDNVHLIGHSLGSHVAGEAGKR-T 182

  Fly   264 TGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVG------SYGFDRPVGHVDFYANW 322
            .|.:..|..||.|.|:|:....:.||...||.:|:.:||...      .:|..:.|||:||:.|.
  Rat   183 FGAIGRITGLDAAEPYFQGTPEEVRLDPTDAQFVDAIHTDAAPIIPNLGFGMSQTVGHLDFFPNG 247

  Fly   323 GSQQPGC-------------FWH------ECSHWRAFMLFAESLARDQATGFL------------ 356
            |.:.|||             .|.      .|:|.|::..:.:|:.  ..|||.            
  Rat   248 GMEMPGCQKNILSQIVDIDGIWEGTRDFAACNHLRSYKYYTDSIV--NPTGFSGFSCSSYNVFSA 310

  Fly   357 -------SQGCP 361
                   |:|||
  Rat   311 NKCFPCGSEGCP 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 80/268 (30%)
PnlipNP_037293.2 Lipase 17..352 CDD:395099 81/272 (30%)
PLAT_PL 355..465 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338999
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.