DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Lpl

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_036730.1 Gene:Lpl / 24539 RGDID:3017 Length:474 Species:Rattus norvegicus


Alignment Length:295 Identity:98/295 - (33%)
Similarity:143/295 - (48%) Gaps:49/295 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 AASLRRSRFSPFNPTRILIHGWLGNENANMYNELLP---AYFDLRNGNYNIFTVDWGRGAIADY- 211
            |.|:....|:..:.|.::||||   ....||...:|   |....|..:.|:..|||...|...| 
  Rat    61 ADSVSNCHFNHSSKTFVVIHGW---TVTGMYESWVPKLVAALYKREPDSNVIVVDWLYRAQQHYP 122

  Fly   212 ITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPA 276
            ::|.| .|.||..:|:|:::|.:|.....:::.|:|:|:|||.||:||. |...::..|..||||
  Rat   123 VSAGY-TKLVGNDVARFINWLEEEFNYPLDNVHLLGYSLGAHAAGVAGS-LTNKKVNRITGLDPA 185

  Fly   277 LPFFRYAKPKERLTAEDADYVEVLHT----SVG-SYGFDRPVGHVDFYANWGSQQPGCFWHE--- 333
            .|.|.||:...||:.:|||:|:||||    |.| |.|..:||||||.|.|.|:.||||...|   
  Rat   186 GPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQPGCNIGEAIR 250

  Fly   334 ---------------CSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQ-----LTRFHRCPKDT 378
                           |||.|:..||.:||..::... .:..|.:.|..:     ..|.:||    
  Rat   251 VIAEKGLGDVDQLVKCSHERSIHLFIDSLLNEENPS-KAYRCNSKEAFEKGLCLSCRKNRC---- 310

  Fly   379 GVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413
               ..:|.::..|.    |:|....|.:|..|.||
  Rat   311 ---NNVGYEINKVR----AKRSSKMYLKTRSQMPY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 95/289 (33%)
LplNP_036730.1 Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 32..53
lipo_lipase 33..472 CDD:132274 98/295 (33%)
Pancreat_lipase_like 37..334 CDD:238363 95/289 (33%)
Essential for determining substrate specificity. /evidence=ECO:0000250|UniProtKB:P06858 243..266 2/22 (9%)
PLAT_LPL 341..465 CDD:238856
Important for interaction with lipoprotein particles. /evidence=ECO:0000250|UniProtKB:P06858 417..421
Important for heparin binding. /evidence=ECO:0000250|UniProtKB:P06858 430..434
Interaction with GPIHBP1. /evidence=ECO:0000250|UniProtKB:P06858 443..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338989
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.