DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Lipc

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_006243421.1 Gene:Lipc / 24538 RGDID:3009 Length:510 Species:Rattus norvegicus


Alignment Length:319 Identity:96/319 - (30%)
Similarity:141/319 - (44%) Gaps:83/319 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 SLRRSRFSPFNPTRILIHGWLGNENANMYNE-----------------LLPAYFDLRNGNYNIFT 200
            :|:...|:..:|..::||||.|:|:|.:..:                 ::.|....::...|:..
  Rat    72 TLQECGFNSSHPLVMIIHGWSGSESATVGKDSDNDSQVDGLLETWIWKIVGALKSRQSQPVNVGL 136

  Fly   201 VDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRF--EDLQLVGFSMGAHVAGLAGKHL- 262
            |||...|...|..|....:.|||.:|..:.:|  |..|:|  ..:.|:|:|:||||:|.||..: 
  Rat   137 VDWISLAYQHYAIAVRNTRVVGQEVAALLLWL--EESMKFSRSKVHLIGYSLGAHVSGFAGSSMG 199

  Fly   263 ---QTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHT----SVG-SYGFDRPVGHVDFY 319
               :.||   |..||||.|.|....|.|||:.:||::|:.:||    .:| |.|..:|:.|.|||
  Rat   200 GKRKIGR---ITGLDPAGPMFEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFY 261

  Fly   320 ANWGSQQPGCFWHE------------------CSHWRAFMLFAESLARD--QATGF-------LS 357
            .|.||.||||.:.|                  |:|.|:..||.:||...  |.|||       .|
  Rat   262 PNGGSFQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSNLQNTGFQCSNMDSFS 326

  Fly   358 QG-CPAAEWQQLTRFHRCPKDTGVMQTMGGDL-----ANVSAEFLAQRQ----GVYYFQ 406
            || |           ..|.|  |...::|.|:     ......||..|.    .||::|
  Rat   327 QGLC-----------LNCKK--GRCNSLGYDIRRDRPRKSKTLFLITRAQSPFKVYHYQ 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 96/319 (30%)
LipcXP_006243421.1 Lipase 18..366 CDD:278576 93/311 (30%)
Pancreat_lipase_like 47..362 CDD:238363 92/307 (30%)
PLAT_LPL 369..504 CDD:238856 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.