DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Lipc

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_006510879.1 Gene:Lipc / 15450 MGIID:96216 Length:526 Species:Mus musculus


Alignment Length:314 Identity:93/314 - (29%)
Similarity:138/314 - (43%) Gaps:73/314 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 SLRRSRFSPFNPTRILIHGWLGNENA-----------------NMYNELLPAYFDLRNGNYNIFT 200
            :|:...|:...|..::||||.|:|:|                 |...:::.|....::...|:..
Mouse    72 TLQECGFNSSQPLIMIIHGWSGSESATVGKDSDSDYQVDGLLENWIWKIVSALKSRQSQPVNVGL 136

  Fly   201 VDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQ-T 264
            |||...|...|..|....:.|||.:|..:.:|.:.|......:.|:|:|:||||:|.||..:. .
Mouse   137 VDWISLAYQHYTIAVQNTRIVGQDVAALLLWLEESAKFSRSKVHLIGYSLGAHVSGFAGSSMDGK 201

  Fly   265 GRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHT----SVG-SYGFDRPVGHVDFYANWGS 324
            .::..|..||||.|.|....|.|||:.:||::|:.:||    .:| |.|..:|:.|.|||.|.||
Mouse   202 NKIGRITGLDPAGPMFEGTSPNERLSPDDANFVDAIHTFTREHMGLSVGIKQPIAHYDFYPNGGS 266

  Fly   325 QQPGCFWHE------------------CSHWRAFMLFAESLARD--QATGF-------LSQG-CP 361
            .||||.:.|                  |:|.|:..||.:||...  |:.||       .||| |.
Mouse   267 FQPGCHFLELYKHIAEHGLNAITQTIKCAHERSVHLFIDSLQHSDLQSIGFQCSDMGSFSQGLCL 331

  Fly   362 AAEWQQLTRFHRCPKDTGVMQTMGGDL-----ANVSAEFLAQRQ----GVYYFQ 406
            :           |.|  |...|:|.|:     ......||..|.    .||::|
Mouse   332 S-----------CKK--GRCNTLGYDIRKDRSGKSKRLFLITRAQSPFKVYHYQ 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 93/314 (30%)
LipcXP_006510879.1 Lipase 18..366 CDD:333880 90/306 (29%)
PLAT_LPL 369..504 CDD:238856 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167835357
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.