DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and Pnliprp2

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:NP_476554.1 Gene:Pnliprp2 / 117554 RGDID:620793 Length:482 Species:Rattus norvegicus


Alignment Length:305 Identity:91/305 - (29%)
Similarity:131/305 - (42%) Gaps:49/305 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 FTSEPVNLYDAAS------LRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIF 199
            :|:|..|.|...|      ::.|.|.....||.::||::.........::....|.:.  ..|..
  Rat    72 YTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDKGEDGWLLDMCKKMFQVE--KVNCI 134

  Fly   200 TVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQT 264
            .|||.||:..:|..|||..:.||..:|..|..|..|.|...|::.|:|.|:||||.|.||:.|: 
  Rat   135 CVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGEAGRRLE- 198

  Fly   265 GRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVG------SYGFDRPVGHVDFYANWG 323
            |.:..|..||||.|.|:....:.||...||.:|:|:||...      .:|..:.|||:||:.|.|
  Rat   199 GHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGG 263

  Fly   324 SQQPGC-------------FWH------ECSHWRAFMLFAESLARDQATGFLSQGCPAAE-WQQL 368
            .:.|||             .|.      .|:|.|::..:|.|:....  |||...|.:.| :||.
  Rat   264 KEMPGCQKNILSTIVDINGIWEGTQNFVACNHLRSYKYYASSILNPD--GFLGYPCSSYEKFQQN 326

  Fly   369 TRF----HRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTND 409
            ..|    ..|||.........|..|.|        :...|..|.|
  Rat   327 DCFPCPEEGCPKMGHYADQFEGKTATV--------EQTVYLNTGD 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 90/303 (30%)
Pnliprp2NP_476554.1 Lipase 31..367 CDD:278576 91/305 (30%)
Pancreat_lipase_like 65..363 CDD:238363 90/303 (30%)
PLAT_PL 370..482 CDD:238857
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338979
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.