DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and LOC101884800

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_005174466.1 Gene:LOC101884800 / 101884800 -ID:- Length:530 Species:Danio rerio


Alignment Length:345 Identity:103/345 - (29%)
Similarity:152/345 - (44%) Gaps:78/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 NTLTAAFGLNVMNKGDQEQNQQFTSEPVNLYD----------AASLRRSRFSPFNPTRILIHGWL 173
            |:...||..|..:..|.|  .:|:...|...|          ..|:....|...:.|.::|||| 
Zfish    23 NSTEEAFASNFTDYSDIE--SKFSIRSVEFPDEDLCYLVPGQQDSISDCNFKNDSQTFLIIHGW- 84

  Fly   174 GNENANMYN----ELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFVDFLHQ 234
              ..|.::.    :|:.|.:| |..:.|:..|||...|...|..::...:.||..:||||::| :
Zfish    85 --SVAGLFESWVYKLVTALYD-REPSANVIVVDWLDRANKHYPKSAENTRLVGADVAKFVNWL-E 145

  Fly   235 EAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEV 299
            |.....|.:.|:|:|:||||||:|| :|...::..|..||||.|.|..|....||:.:||.:|:|
Zfish   146 ELDYPLEKVHLLGYSLGAHVAGVAG-NLTNNKVHRITGLDPAGPSFENADILRRLSPDDASFVDV 209

  Fly   300 LHTSVG-----SYGFDRPVGHVDFYANWGSQQPGC-FWH-----------------ECSHWRAFM 341
            |||:..     |.|..|||||||.|.|.|:.|||| ..|                 :|||.|:..
Zfish   210 LHTNTRGSPDLSIGIQRPVGHVDIYPNGGTFQPGCSIQHTMKLIATCGIYNMDQIVKCSHERSIH 274

  Fly   342 LFAESL-------------ARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSA 393
            ||.:||             :||.....|...|         |.:||       .|:|.::..:. 
Zfish   275 LFIDSLVNQAYQSWAFRCASRDSFNKGLCLSC---------RKNRC-------NTLGYNVKKIR- 322

  Fly   394 EFLAQRQGVYYFQTNDQPPY 413
               :.|....|.:|.:..|:
Zfish   323 ---STRSTKMYLKTREMMPF 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 96/320 (30%)
LOC101884800XP_005174466.1 lipo_lipase 35..473 CDD:132274 99/333 (30%)
Pancreat_lipase_like 39..335 CDD:238363 97/323 (30%)
PLAT 342..464 CDD:294016
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.