DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and lipg

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_002934486.2 Gene:lipg / 100498513 XenbaseID:XB-GENE-1011639 Length:500 Species:Xenopus tropicalis


Alignment Length:273 Identity:87/273 - (31%)
Similarity:129/273 - (47%) Gaps:36/273 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 TRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYITASYRVKPVGQVLAKFV 229
            |.|:||||..:.....:...|......|....|:..|||...|...|..|......||:.:|..:
 Frog    87 TFIVIHGWSMSGLFETWLHRLVGALQERERYANVIVVDWMNLAHQLYPDAVNNTMVVGKDIAVLM 151

  Fly   230 DFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDA 294
            |:|.::|.:..|::.|:|:|:||||||.||..: |||:..|..||||.|.|..|:..:||:.:||
 Frog   152 DWLQEKANLSLENVHLIGYSLGAHVAGYAGNFV-TGRIGRITGLDPAGPMFEGAEAHKRLSPDDA 215

  Fly   295 DYVEVLHT----SVG-SYGFDRPVGHVDFYANWGSQQPGCFWHE---------------CSHWRA 339
            |:|:||||    ::| |.|...|:||:|.|.|.|..||||...:               |.|.|:
 Frog   216 DFVDVLHTYTREALGVSIGIQMPIGHIDIYPNGGDFQPGCGLSDVLGAIAYGSIGDAVKCEHERS 280

  Fly   340 FMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPKDTGVMQTMGGDLANV----SAEFLAQRQ 400
            ..||.:||.......|..| |..::     ||.:     |:..:...:..|.    :....::|.
 Frog   281 VHLFVDSLIHKDQESFAFQ-CTDSD-----RFKK-----GICLSCRKNRCNAIGYNAKRMRSKRN 334

  Fly   401 GVYYFQTNDQPPY 413
            ...:.:|..|.||
 Frog   335 SKMFLKTRAQMPY 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 84/267 (31%)
lipgXP_002934486.2 lipo_lipase 63..488 CDD:132274 87/273 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.