DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and LOC100331214

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_002666287.3 Gene:LOC100331214 / 100331214 -ID:- Length:501 Species:Danio rerio


Alignment Length:367 Identity:108/367 - (29%)
Similarity:163/367 - (44%) Gaps:84/367 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 TGPLKSEKESPHRRLFQQVVGNTLTAAFGLNVMNKGD----QEQNQQFT----SEP------VNL 148
            |||..:..|.          ||.|...|...:.:..|    ::.|.:|:    |:|      :..
Zfish    18 TGPFIAALEE----------GNVLNGVFDHFLEDLRDLSDVKKLNVKFSLRNPSQPDDDVCYIVR 72

  Fly   149 YDAASLRRSRFSPFNPTRILIHGWLGNENANMYNELLPAYFDLRNGNYNIFTVDWGRGAIADYIT 213
            ..|.:|....|:..:.|.::||||..:.....:.|.|.|....|..:.|:..|||...|...|:.
Zfish    73 GKAETLSSCNFNHTSKTILVIHGWTVSGLFESWVEKLVAALYNREKDANVIVVDWLDTAQDHYVV 137

  Fly   214 ASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGAHVAGLAGKHLQTGRLRMIRALDPALP 278
            |:...|.||:.:..|:|::.:.:.:..|:|.|:|:|:||||||.||.| .|.::..|..||||.|
Zfish   138 AAQNTKMVGREIGLFIDWIEETSNVPLENLHLIGYSLGAHVAGFAGSH-TTNKIGRITGLDPAGP 201

  Fly   279 FFRYAKPKERLTAEDADYVEVLHT----SVG-SYGFDRPVGHVDFYANWGSQQPGCFWH------ 332
            .|.......||:.:||.:|:||||    |:| |.|.::||||||.|.|.||.||||...      
Zfish   202 DFEGVHAHGRLSPDDAHFVDVLHTFTRGSLGLSIGIEQPVGHVDIYPNGGSFQPGCNLRGALEKM 266

  Fly   333 ------------ECSHWRAFMLFAESLARDQATGFLSQGCPAAEWQQLTRFHRCPK----DTGV- 380
                        .|.|.|:..||.:||..::|.|               |.:.|..    |.|| 
Zfish   267 ASYGIFAINNAIRCEHERSIHLFIDSLLNEEAAG---------------RAYSCGSNDMFDRGVC 316

  Fly   381 -------MQTMGGDLANV----SAEFLAQRQG-----VYYFQ 406
                   ..|:|.|::.|    |.:...:.:|     |:::|
Zfish   317 LQCRKNGCNTVGYDISKVRKARSVKMFTKTRGSMPFRVFHYQ 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 99/323 (31%)
LOC100331214XP_002666287.3 lipo_lipase 47..487 CDD:132274 99/328 (30%)
Pancreat_lipase_like 51..347 CDD:238363 96/311 (31%)
PLAT_LPL 355..485 CDD:238856 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578518
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28N19
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.