DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4582 and lipib

DIOPT Version :9

Sequence 1:NP_651403.1 Gene:CG4582 / 43086 FlyBaseID:FBgn0039344 Length:432 Species:Drosophila melanogaster
Sequence 2:XP_001342691.1 Gene:lipib / 100003046 ZFINID:ZDB-GENE-091118-47 Length:448 Species:Danio rerio


Alignment Length:315 Identity:102/315 - (32%)
Similarity:137/315 - (43%) Gaps:75/315 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 GDQEQNQQFTSEPVNLYDAASLRRSRFSPFNPTRILIHG---------WLGNENANMYNELLPAY 188
            |.:..:..||.:|:            |:...||..:|||         |:     |....||.|.
Zfish    55 GQELPHHNFTQQPL------------FNVTRPTTFVIHGYRPTGAPPIWI-----NHIVHLLAAQ 102

  Fly   189 FDLRNGNYNIFTVDWGRGAI-ADYITASYRVKPVGQVLAKFVDFLHQEAGMRFEDLQLVGFSMGA 252
            .|:     ||..|||.|||. .:|:||....:.....:.:|::.:.:| |...:.:.|:|.|:||
Zfish   103 KDM-----NILVVDWNRGAANLNYLTAVANTRGTALNITRFIESMEKE-GASLDSIHLIGVSLGA 161

  Fly   253 HVAGLAGKHLQTGRLRMIRALDPALPFFRYAKPKERLTAEDADYVEVLHTSVGSYGFDRPVGHVD 317
            ||||..|..| .||:..|..||||.|.|....|:|||...||.:|:||||.:.|:|.....||:|
Zfish   162 HVAGFIGAML-GGRVGRITGLDPAGPMFASVSPEERLDPTDAQFVDVLHTDMNSFGLRGTHGHID 225

  Fly   318 FYANWGSQQPGC--------FWHECSHWRAFMLFAESLARD-QATG--------FLSQGC----- 360
            ||||.|..||||        .:..|.|.|:..|:..||.|. ..||        |||..|     
Zfish   226 FYANGGLDQPGCPKTIFSGKSYFVCDHQRSVFLYLCSLNRTCSLTGYPCSSYSDFLSGQCLQCET 290

  Fly   361 --PAAEWQQLTRFHRCPKDTGVMQTMGGDLANVSAEFLAQRQGVYYFQTNDQPPY 413
              ||:          ||       .:|.||:......|...|...||.|..:.||
Zfish   291 FKPAS----------CP-------VLGYDLSQWRDTLLRLGQTRAYFSTTAELPY 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4582NP_651403.1 Pancreat_lipase_like 138..409 CDD:238363 99/304 (33%)
lipibXP_001342691.1 Lipase 37..328 CDD:278576 100/313 (32%)
Pancreat_lipase_like 40..324 CDD:238363 100/309 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578548
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11610
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.