DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5107 and CG8664

DIOPT Version :9

Sequence 1:NP_651401.1 Gene:CG5107 / 43084 FlyBaseID:FBgn0039342 Length:213 Species:Drosophila melanogaster
Sequence 2:NP_001285370.1 Gene:CG8664 / 32719 FlyBaseID:FBgn0030836 Length:214 Species:Drosophila melanogaster


Alignment Length:220 Identity:96/220 - (43%)
Similarity:138/220 - (62%) Gaps:14/220 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKAITVCLLVLVSATCLLTTRANAIELLENENFDYDFDFE------SELEQLLDELDNDTDYMDV 59
            ||.:.|||||:.||:.||.| |||..:...|:|:...|.|      :||..:.||      :|.|
  Fly     1 MKVLNVCLLVVASASFLLAT-ANASAVGAFEDFEPYTDAELKDLYAAELMAMEDE------FMGV 58

  Fly    60 EAQGFIRTCLKILRKALKTVRGTNCIIKEVTNILSSCTSYVDAIDACGTAIPKDVAKIVDSVKEI 124
            |..|||.:|.|||....|.:.||.||::||.|:|.:||:|||.:..|...||||:..::::||::
  Fly    59 EQFGFIGSCRKILWAGYKGINGTKCIVEEVANVLLTCTNYVDDLSTCTGDIPKDIQAMLNNVKQM 123

  Fly   125 IKICDDILHLHSKLCA-TDKSVGSSIKNSAKCFWKLFKASMRLTRKINKTLKLIAKLPADTSSCF 188
            |...:.|:::.|:||| |.:||.||.|:..:|..|.|.|:|.|.|::|..:|..|.||.:||||:
  Fly   124 IITSNKIINMKSELCASTSRSVVSSTKSFMRCTLKAFYATMSLVRRMNTLIKQGAALPFNTSSCY 188

  Fly   189 VNATNKVTASFNSFLPNIDVCIESM 213
            |:||.||....|:|:|||:.||.||
  Fly   189 VDATKKVVDGCNAFVPNINTCIASM 213



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445336
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2F7VM
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016623
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.830

Return to query results.
Submit another query.