DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED28 and MED28

DIOPT Version :9

Sequence 1:NP_651397.1 Gene:MED28 / 43079 FlyBaseID:FBgn0039337 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_079481.2 Gene:MED28 / 80306 HGNCID:24628 Length:178 Species:Homo sapiens


Alignment Length:139 Identity:55/139 - (39%)
Similarity:82/139 - (58%) Gaps:7/139 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPY 75
            |:||.|.:|::|..:|..|:..:||::|||...|.:...:|:|:|||.|.||||||..:|..||.
Human    44 LVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPE 108

  Fly    76 MLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTP-PIGS-GMLQGPGGGMP 138
            .:||::..:|..|:|||:||:|||..:|..|:..|.||.. .|.:|.. |.|| ..|:.....:|
Human   109 QVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINV-QHKKPADIPQGSLAYLEQASANIP 172

  Fly   139 PMGGTPPRP 147
                .|.:|
Human   173 ----APLKP 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED28NP_651397.1 Med28 39..130 CDD:288448 40/92 (43%)
MED28NP_079481.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..44 55/139 (40%)
Med28 43..143 CDD:402955 43/98 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157035
Domainoid 1 1.000 61 1.000 Domainoid score I10548
eggNOG 1 0.900 - - E1_2CMY4
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11873
Inparanoid 1 1.050 98 1.000 Inparanoid score I5021
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1504193at2759
OrthoFinder 1 1.000 - - FOG0006497
OrthoInspector 1 1.000 - - oto89437
orthoMCL 1 0.900 - - OOG6_107353
Panther 1 1.100 - - LDO PTHR13512
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4649
SonicParanoid 1 1.000 - - X5477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.