DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED28 and Med28

DIOPT Version :10

Sequence 1:NP_651397.1 Gene:MED28 / 43079 FlyBaseID:FBgn0039337 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_080171.1 Gene:Med28 / 66999 MGIID:1914249 Length:178 Species:Mus musculus


Alignment Length:130 Identity:53/130 - (40%)
Similarity:79/130 - (60%) Gaps:3/130 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPY 75
            |:||.|.:|::|..:|..|:..:||::|||...|.:...:|:|:|||.|.||||||..:|..||.
Mouse    44 LVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPD 108

  Fly    76 MLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTP-PIGS-GMLQGPGGGMP 138
            .:||::..:|..|:|||:||:|||..:|..|:..|.||.. .|.:|.. |.|| ..|:.....:|
Mouse   109 QVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINV-QHKKPADMPQGSLAFLEQASANIP 172

  Fly   139  138
            Mouse   173  172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED28NP_651397.1 Med28 10..110 CDD:463302 43/98 (44%)
Med28NP_080171.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Med28 43..143 CDD:463302 43/98 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.