DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED28 and med28

DIOPT Version :9

Sequence 1:NP_651397.1 Gene:MED28 / 43079 FlyBaseID:FBgn0039337 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001007771.1 Gene:med28 / 493610 ZFINID:ZDB-GENE-041121-4 Length:179 Species:Danio rerio


Alignment Length:148 Identity:56/148 - (37%)
Similarity:81/148 - (54%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NESGGGNLMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFL 68
            |......|:||.|.:|::|..:|..|:..:||::|||...|.:...:|:|||||.|.||||||..
Zfish    38 NRGANNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQ 102

  Fly    69 VSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTPPIGSGMLQGP 133
            :|..||..:.|::..:|..|:||||.|:|||..::..|:..|.||.. .|.:||.     :.|||
Zfish   103 LSVQKPEQVEKEDASELKNELQRKEMLIQKHLAKIHHWQQVLEDINV-QHKKPTE-----LPQGP 161

  Fly   134 GGGMPPMGGTPPRPGMMP 151
            ...:.......|.| |.|
Zfish   162 LAFLEQASANLPAP-MKP 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED28NP_651397.1 Med28 39..130 CDD:288448 37/90 (41%)
med28NP_001007771.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 1/4 (25%)
Med28 73..166 CDD:288448 40/98 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592706
Domainoid 1 1.000 59 1.000 Domainoid score I10718
eggNOG 1 0.900 - - E1_2CMY4
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11873
Inparanoid 1 1.050 100 1.000 Inparanoid score I4998
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1504193at2759
OrthoFinder 1 1.000 - - FOG0006497
OrthoInspector 1 1.000 - - oto38770
orthoMCL 1 0.900 - - OOG6_107353
Panther 1 1.100 - - LDO PTHR13512
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4649
SonicParanoid 1 1.000 - - X5477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.