DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED28 and Med28

DIOPT Version :9

Sequence 1:NP_651397.1 Gene:MED28 / 43079 FlyBaseID:FBgn0039337 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001100687.1 Gene:Med28 / 305391 RGDID:1305875 Length:178 Species:Rattus norvegicus


Alignment Length:118 Identity:51/118 - (43%)
Similarity:75/118 - (63%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPY 75
            |:||.|.:|::|..:|..|:..:||::|||...|.:...:|:|:|||.|.||||||..:|..||.
  Rat    44 LVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPD 108

  Fly    76 MLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTP-PIGS 127
            .:||::..:|..|:|||:||:|||..:|..|:..|.||.. .|.:|.. |.||
  Rat   109 QVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINV-QHKKPADMPQGS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED28NP_651397.1 Med28 39..130 CDD:288448 40/90 (44%)
Med28NP_001100687.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Med28 43..143 CDD:402955 43/98 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166350994
Domainoid 1 1.000 61 1.000 Domainoid score I10258
eggNOG 1 0.900 - - E1_2CMY4
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11873
Inparanoid 1 1.050 99 1.000 Inparanoid score I4918
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1504193at2759
OrthoFinder 1 1.000 - - FOG0006497
OrthoInspector 1 1.000 - - oto96562
orthoMCL 1 0.900 - - OOG6_107353
Panther 1 1.100 - - LDO PTHR13512
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5477
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.