DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED28 and Med28

DIOPT Version :10

Sequence 1:NP_651397.1 Gene:MED28 / 43079 FlyBaseID:FBgn0039337 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001100687.1 Gene:Med28 / 305391 RGDID:1305875 Length:178 Species:Rattus norvegicus


Alignment Length:118 Identity:51/118 - (43%)
Similarity:75/118 - (63%) Gaps:2/118 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKRFLVSTLKPY 75
            |:||.|.:|::|..:|..|:..:||::|||...|.:...:|:|:|||.|.||||||..:|..||.
  Rat    44 LVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPD 108

  Fly    76 MLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTP-PIGS 127
            .:||::..:|..|:|||:||:|||..:|..|:..|.||.. .|.:|.. |.||
  Rat   109 QVIKEDVSELRSELQRKDALVQKHLTKLRHWQQVLEDINV-QHKKPADMPQGS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED28NP_651397.1 Med28 10..110 CDD:463302 43/98 (44%)
Med28NP_001100687.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
Med28 43..143 CDD:463302 43/98 (44%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.