DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED28 and med28

DIOPT Version :9

Sequence 1:NP_651397.1 Gene:MED28 / 43079 FlyBaseID:FBgn0039337 Length:189 Species:Drosophila melanogaster
Sequence 2:NP_001096476.1 Gene:med28 / 100125095 XenbaseID:XB-GENE-961728 Length:169 Species:Xenopus tropicalis


Alignment Length:150 Identity:60/150 - (40%)
Similarity:86/150 - (57%) Gaps:9/150 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASNESGGGNLMDEFEEAFQSCLLTLTKQEPNSGTNKEEIDLEVQKTTNRFIDVARQMEAFFLQKR 66
            |.|.|  ..|:|:.|.:|::|..:|..|:..:||::|||...|::...:|:|||||.|.||||||
 Frog    28 AKNPS--STLVDDLESSFEACFASLVSQDYVNGTDQEEIRTGVEQCIQKFLDVARQTECFFLQKR 90

  Fly    67 FLVSTLKPYMLIKDENQDLSIEIQRKEALLQKHYNRLEEWKACLSDIQQGVHSRPTPPIGSGMLQ 131
            ..:|..||..:||::..:|..|:||||||:|||..:|..|:..|.:| .|.|.:.     |.|.|
 Frog    91 LQLSVQKPEQVIKEDVSELRNELQRKEALIQKHLTKLRSWQQVLEEI-NGQHKKT-----SEMPQ 149

  Fly   132 GPGGGMPPMGGTPPRPGMMP 151
            ||...:.......|.| |.|
 Frog   150 GPLAYLEQASANIPAP-MKP 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED28NP_651397.1 Med28 39..130 CDD:288448 39/90 (43%)
med28NP_001096476.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35 3/8 (38%)
Med28 63..157 CDD:371617 43/99 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9981
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H11873
Inparanoid 1 1.050 102 1.000 Inparanoid score I4836
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1504193at2759
OrthoFinder 1 1.000 - - FOG0006497
OrthoInspector 1 1.000 - - oto103266
Panther 1 1.100 - - LDO PTHR13512
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4649
SonicParanoid 1 1.000 - - X5477
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.