DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4553 and RRG9

DIOPT Version :9

Sequence 1:NP_651396.1 Gene:CG4553 / 43078 FlyBaseID:FBgn0039336 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_014186.1 Gene:RRG9 / 855508 SGDID:S000005157 Length:214 Species:Saccharomyces cerevisiae


Alignment Length:241 Identity:52/241 - (21%)
Similarity:96/241 - (39%) Gaps:59/241 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RMIQRGLHTARSCLLARAPRRANPGLGYQLEQLQEHPEKSSEASEDYADLESDFMDVQKTHRQYE 68
            |:..|..|    ||  |.....|...|:..:::.:...|||.:::::.:   ...|..|...:::
Yeast     5 RIACRSFH----CL--RCGPLLNENRGWSSKKIIKLVNKSSLSNKEFTE---KVRDGTKDIPEWK 60

  Fly    69 REQQQHRDRIRQFMIKHKYFRDAKLPNLLLHAEKEQMRLLHERDPEEWSVERLAESFPATPDIVQ 133
            :::...|.:::.        :....|..:...:.|.:|||....| |.:...||:.|..:|:.|:
Yeast    61 KQKMAVRKKLQG--------QRWNPPKKISQEQMEALRLLKFNFP-ELTASDLADRFKISPEAVR 116

  Fly   134 KILRAKWR-------------PRSVQRI-----RSHDETVIKNWQLLGTGK---GDFSIPPSLLQ 177
            :||::.|:             .|..:||     |..|...:.| |::.:.|   |..|..|.|:.
Yeast   117 RILKSNWKRTDEENNNTYERWKRRGERIKEMYQRKEDADFVSN-QIVTSRKIILGSNSNSPELIA 180

  Fly   178 HLQKFAERRWQDLRELKIQDWPTKSQLPTPQGNEFRKL-----LGS 218
                      :::|..|    |.|....||:.....||     |||
Yeast   181 ----------RNVRTFK----PFKPNNSTPEKKNTNKLYILKHLGS 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4553NP_651396.1 Neugrin 103..>157 CDD:283952 19/71 (27%)
RRG9NP_014186.1 Neugrin 77..>121 CDD:399425 14/44 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13475
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.