DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4553 and ngrn

DIOPT Version :9

Sequence 1:NP_651396.1 Gene:CG4553 / 43078 FlyBaseID:FBgn0039336 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001038718.1 Gene:ngrn / 569275 ZFINID:ZDB-GENE-060503-19 Length:289 Species:Danio rerio


Alignment Length:353 Identity:76/353 - (21%)
Similarity:136/353 - (38%) Gaps:103/353 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LARAPRRANPG-LGYQLEQLQEHPEKSSEAS--EDYADLESDFMDVQKTHRQYEREQQQHRDRIR 79
            :.:|.|.|:.| .|:    :.::|::..:.:  ||..|     ||..:........:::.|.:..
Zfish    23 VCQARRHASRGSFGW----MSKNPKQKQQGAVFEDDHD-----MDAVEVKLDSIISEERRRQKAA 78

  Fly    80 QFMIKHKYFRDAKLPNLLLHAEK-EQMRLLHERDPEEWSVERLAESFPATPDIVQKILRAKWRPR 143
            :|.|..:.......|...|..:. ||:|.|.:..||||:::||||.|..:||::.::||:.:.|.
Zfish    79 KFHIIKRKMNTPGAPQRKLSWDAIEQIRYLKQESPEEWTLQRLAEGFSVSPDVISRVLRSTFTPP 143

  Fly   144 SVQRIRSHDETVIKNWQLLGTGKGDFSIPPSL-LQHLQ--KFAERRWQDLRELKIQDWPTKSQLP 205
            :.:::                 |.|..:.||. .|:|:  |..:.|.|            ||..|
Zfish   144 AARKL-----------------KQDAKVSPSSGPQYLKDGKAEQSRLQ------------KSLTP 179

  Fly   206 T---PQGNEFRKLLGSSSKTTEEMPTPQIPSGYEAPPSAAEDETYLL-------DKIRNKKKMRL 260
            :   |..|...    |:.||.:...|...||   |.......:|.:|       |::.:|.:|.:
Zfish   180 SVLLPSANTSH----SALKTLDTKQTGLTPS---AGHITLSKQTAVLNVAPEYQDRLESKGEMDV 237

  Fly   261 QELKELQLVESAPAVPEEMKRPIENPSGTGFLPSFVPKFASSEIVISAADQRKYEITQVKTRIVI 325
            .:..|.:                |...|                 :...|:...:|||  |....
Zfish   238 NDDVEFE----------------EEWDG-----------------VILTDEELEKITQ--TLHEK 267

  Fly   326 PRKLHRQGATYRVEDAYYDDDGELLYRV 353
            |..:.::|..      ::|.:|..||||
Zfish   268 PSPVEQRGRD------FFDSEGNFLYRV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4553NP_651396.1 Neugrin 103..>157 CDD:283952 18/53 (34%)
ngrnNP_001038718.1 Neugrin 87..289 CDD:283952 60/278 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D322069at33208
OrthoFinder 1 1.000 - - FOG0008328
OrthoInspector 1 1.000 - - oto41116
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13475
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5347
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
66.100

Return to query results.
Submit another query.