DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG4553 and NGRN

DIOPT Version :9

Sequence 1:NP_651396.1 Gene:CG4553 / 43078 FlyBaseID:FBgn0039336 Length:363 Species:Drosophila melanogaster
Sequence 2:NP_001028260.2 Gene:NGRN / 51335 HGNCID:18077 Length:291 Species:Homo sapiens


Alignment Length:328 Identity:78/328 - (23%)
Similarity:129/328 - (39%) Gaps:100/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 DLESDFMDVQKTHRQYEREQQQHRDRIRQFMIKHKYFRDAKLPNLLLHAEKEQMRLLHERDPEEW 116
            |.:||:...::..::.|...::.:..||...|:.:.......|..|.....||:|.|||..||.|
Human    38 DPDSDWEPEERELQEVESTLKRQKQAIRFQKIRRQMEAPGAPPRTLTWEAMEQIRYLHEEFPESW 102

  Fly   117 SVERLAESFPATPDIVQKILRAKWRPRSVQRIRSHDETVIKNWQLLGTGKGDFSIPPSLLQHLQK 181
            ||.||||.|..:.|:::::|::|:.|...|::: .|:.|:|...|..:           ||||: 
Human   103 SVPRLAEGFDVSTDVIRRVLKSKFLPTLEQKLK-QDQKVLKKAGLAHS-----------LQHLR- 154

  Fly   182 FAERRWQDLRELKIQDWPTKSQLPTPQGNEFRKLLGSSSKTTEEMPTPQIPSGYEAPP------- 239
                                     ..||. .|||.:....:..:..|    |:||..       
Human   155 -------------------------GSGNT-SKLLPAGHSVSGSLLMP----GHEASSKDPNHST 189

  Fly   240 --SAAEDETYLLDKIRNKK--KMRLQELKELQLVESAP-AVPEEMKR---PIENPSGT--GFLPS 294
              ...|.:|:..:..|.:|  ...:|:|:|..:..:|| ..|.|:::   ..|:|.||  |.|||
Human   190 ALKVIESDTHRTNTPRRRKGRNKEIQDLEESFVPVAAPLGHPRELQKYSSDSESPRGTGSGALPS 254

  Fly   295 ---------FVPKFASSEIVISAADQRKYEITQVKTRIVIPRKLHRQGATYRVEDAYYDDDGELL 350
                     ..|...||::|     ||..|                          ::|.:|..|
Human   255 GQKLEELKAEEPDNFSSKVV-----QRGRE--------------------------FFDSNGNFL 288

  Fly   351 YRV 353
            ||:
Human   289 YRI 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG4553NP_651396.1 Neugrin 103..>157 CDD:283952 23/53 (43%)
NGRNNP_001028260.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..48 3/9 (33%)
Neugrin 73..291 CDD:283952 70/291 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..270 29/119 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D322069at33208
OrthoFinder 1 1.000 - - FOG0008328
OrthoInspector 1 1.000 - - oto89969
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13475
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5347
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.