DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and AT1G33610

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_174625.3 Gene:AT1G33610 / 840255 AraportID:AT1G33610 Length:478 Species:Arabidopsis thaliana


Alignment Length:406 Identity:95/406 - (23%)
Similarity:149/406 - (36%) Gaps:98/406 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ICTNVVIGRSDYVIL---------SQAPIGGTTMLTFLNSSIAKIPHL-------------LFDT 87
            ||.|     ||.|.:         .:..:.||     |:.|:||:.||             .|..
plant    67 ICFN-----SDRVTMLELVGFPKKPERSLSGT-----LSPSLAKLQHLSVISLGGHVNITGSFPK 121

  Fly    88 F----PDLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLK-DIPK---------------NI 132
            |    |.|:.:.::|..|...........|.|..:||..|:.. .||.               |:
plant   122 FLLQLPKLRYVDIQNNRLSGPLPANIGVLSLLEEIFLQGNKFTGPIPNSISNLTRLSYLIFGGNL 186

  Fly   133 FLGADNLATLHLQGNQLKQLGNHS--------FHALKEVKELSLAENQL-EQISLGVFSGMRKLM 188
            ..|...|...:|:..|..|||::.        |.::|.:|.|.|:.|:. .::.|.:.:....|:
plant   187 LTGTIPLGIANLKLMQNLQLGDNRLSGTIPDIFESMKLLKFLDLSSNEFYGKLPLSIATLAPTLL 251

  Fly   189 DLNLAGNRLDALPRGVFDRNLNLTKLNLARNRFTAFESELLKLQPVFTQLDISGNI----FQELT 249
            .|.::.|.|.........|...|.||:|::|||:....:..........||:|.|:    |.:||
plant   252 ALQVSQNNLSGAIPNYISRFNKLEKLDLSKNRFSGVVPQGFVNLTNINNLDLSHNLLTGQFPDLT 316

  Fly   250 LN-FTMLD--------------VAIAHSCDLRRLTVYGVIHELDLHNNSLREMPHIPLAANVSSL 299
            :| ...||              |.:..|..|.:|...|:...||      ...|..||..:.  :
plant   317 VNTIEYLDLSYNQFQLETIPQWVTLLPSVFLLKLAKCGIKMSLD------DWKPAEPLYYHY--I 373

  Fly   300 DLSHNPLGNLQGNPLRRFTSLLRLNLSATGAH---ELPEGLFKKQSHLQMLDISGNSIYSLKITI 361
            |||.|.:    ...|.||.:..|..|....|.   ....|.......|:.||:|.|.::. |:.:
plant   374 DLSKNEI----SGSLERFLNETRYLLEFRAAENKLRFDMGNLTFPRTLKTLDLSRNLVFG-KVPV 433

  Fly   362 FDSLKALQYFYFQQNN 377
              ::..||.....||:
plant   434 --TVAGLQRLNLSQNH 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 76/320 (24%)
LRR_8 91..149 CDD:290566 14/73 (19%)
leucine-rich repeat 91..114 CDD:275380 3/22 (14%)
leucine-rich repeat 115..138 CDD:275380 8/38 (21%)
LRR_8 138..197 CDD:290566 16/67 (24%)
leucine-rich repeat 139..162 CDD:275380 7/30 (23%)
leucine-rich repeat 163..186 CDD:275380 5/23 (22%)
LRR_8 185..243 CDD:290566 15/57 (26%)
leucine-rich repeat 187..210 CDD:275380 5/22 (23%)
leucine-rich repeat 211..283 CDD:275380 24/90 (27%)
leucine-rich repeat 284..319 CDD:275380 10/34 (29%)
LRR_8 318..377 CDD:290566 13/61 (21%)
leucine-rich repeat 320..343 CDD:275380 4/25 (16%)
leucine-rich repeat 344..365 CDD:275380 6/20 (30%)
AT1G33610NP_174625.3 PLN00113 29..>477 CDD:215061 95/406 (23%)
leucine-rich repeat 129..152 CDD:275380 3/22 (14%)
leucine-rich repeat 153..176 CDD:275380 6/22 (27%)
leucine-rich repeat 177..200 CDD:275380 4/22 (18%)
leucine-rich repeat 201..224 CDD:275380 5/22 (23%)
leucine-rich repeat 225..249 CDD:275380 5/23 (22%)
leucine-rich repeat 250..273 CDD:275380 5/22 (23%)
leucine-rich repeat 274..297 CDD:275380 7/22 (32%)
leucine-rich repeat 298..319 CDD:275380 7/20 (35%)
leucine-rich repeat 350..416 CDD:275380 18/77 (23%)
leucine-rich repeat 417..438 CDD:275380 6/23 (26%)
leucine-rich repeat 439..467 CDD:275380 3/9 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.