DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and RLP31

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_187188.2 Gene:RLP31 / 819701 AraportID:AT3G05370 Length:860 Species:Arabidopsis thaliana


Alignment Length:473 Identity:114/473 - (24%)
Similarity:173/473 - (36%) Gaps:106/473 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LPPSYHLATPSSGSGQLRRLWLQDHCSAGICTNVVIGRSDYVILSQAPIGGTTMLTFL----NSS 76
            :|||.         |.|.||.:.|     :..|.::|:      ..|.||..|.|.:|    |..
plant   148 VPPSI---------GNLSRLTILD-----LWDNKLVGQ------LPASIGNLTQLEYLIFSHNKF 192

  Fly    77 IAKIPHLLFDTFPDLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLK-DIPKNIFLGADNLA 140
            ...|| :.|.....|.|:.:.|.|.|:.......|..||....:|.|... .:||::|. ..:|.
plant   193 SGNIP-VTFSNLTKLLVVNLYNNSFESMLPLDMSGFQNLDYFNVGENSFSGTLPKSLFT-IPSLR 255

  Fly   141 TLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNRLDALPRGVF 205
            ..:|:||..|  |...|.                    .::|...:|..|.|:.|:.|.......
plant   256 WANLEGNMFK--GPIEFR--------------------NMYSPSTRLQYLFLSQNKFDGPIPDTL 298

  Fly   206 DRNLNLTKLNLARNRFTAFESELLKLQPVFTQLDISGN------IFQELT-------LNFTM--L 255
            .:.|||.:|:|:.|..|......|...|...::::.||      .|..::       |||..  .
plant   299 SQYLNLIELDLSFNNLTGSFPTFLFTIPTLERVNLEGNHLKGPVEFGNMSSSSSLKFLNFAQNEF 363

  Fly   256 DVAIAHSCDLRRLTVYGVIHELDL-HNNSLREMPH-IPLAANVSSLDLSHNPLGNLQGNP---LR 315
            :.:|..|     ::.|..:.||.| .||.:..:|. |...|.:....|..|   |:.|..   |.
plant   364 NGSIPES-----VSQYLNLEELHLSFNNFIGTIPRSISKLAKLEYFCLEDN---NMVGEVPSWLW 420

  Fly   316 RFTSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKALQYFYFQQNNWNC 380
            |.|.:...|.|.....|..|||  .::.:|.||:|.||...........|::|:......|.:|.
plant   421 RLTMVALSNNSFNSFGESSEGL--DETQVQWLDLSSNSFQGPFPHWICKLRSLEILIMSDNRFNG 483

  Fly   381 DFLQLLMSSFVKRKDISFMEDITAPELVDDYV---------------DGIACWYESDKQSKKCES 430
            .....|.|..|...|:....:..:..|.|.:|               ||:.     .|....|: 
plant   484 SIPPCLSSFMVSLTDLILRNNSLSGPLPDIFVNATKLLSLDVSRNKLDGVL-----PKSLIHCK- 542

  Fly   431 GGSDAAMELSVVR-NEIK 447
                 ||:|..|| |:||
plant   543 -----AMQLLNVRSNKIK 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 71/290 (24%)
LRR_8 91..149 CDD:290566 17/58 (29%)
leucine-rich repeat 91..114 CDD:275380 6/22 (27%)
leucine-rich repeat 115..138 CDD:275380 6/23 (26%)
LRR_8 138..197 CDD:290566 12/58 (21%)
leucine-rich repeat 139..162 CDD:275380 7/22 (32%)
leucine-rich repeat 163..186 CDD:275380 1/22 (5%)
LRR_8 185..243 CDD:290566 14/57 (25%)
leucine-rich repeat 187..210 CDD:275380 5/22 (23%)
leucine-rich repeat 211..283 CDD:275380 20/87 (23%)
leucine-rich repeat 284..319 CDD:275380 9/38 (24%)
LRR_8 318..377 CDD:290566 15/58 (26%)
leucine-rich repeat 320..343 CDD:275380 6/22 (27%)
leucine-rich repeat 344..365 CDD:275380 6/20 (30%)
RLP31NP_187188.2 leucine-rich repeat 422..446 CDD:275380 7/25 (28%)
leucine-rich repeat 447..470 CDD:275380 7/22 (32%)
leucine-rich repeat 471..495 CDD:275380 5/23 (22%)
leucine-rich repeat 496..519 CDD:275380 4/22 (18%)
leucine-rich repeat 520..543 CDD:275380 4/33 (12%)
leucine-rich repeat 544..565 CDD:275380 7/12 (58%)
leucine-rich repeat 568..593 CDD:275380
leucine-rich repeat 594..621 CDD:275380
leucine-rich repeat 622..692 CDD:275380
PLN00113 <681..758 CDD:331614
leucine-rich repeat 693..716 CDD:275380
leucine-rich repeat 717..738 CDD:275380
LRRNT_2 33..78 CDD:311940
PLN00113 60..>610 CDD:331614 114/473 (24%)
leucine-rich repeat 86..109 CDD:275380
leucine-rich repeat 110..133 CDD:275380
leucine-rich repeat 134..157 CDD:275380 5/17 (29%)
leucine-rich repeat 158..181 CDD:275380 7/33 (21%)
leucine-rich repeat 182..205 CDD:275380 6/23 (26%)
leucine-rich repeat 206..229 CDD:275380 6/22 (27%)
leucine-rich repeat 230..253 CDD:275380 6/23 (26%)
leucine-rich repeat 254..279 CDD:275380 8/46 (17%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 328..376 CDD:275380 9/52 (17%)
leucine-rich repeat 377..398 CDD:275380 7/20 (35%)
leucine-rich repeat 401..421 CDD:275380 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.