DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and LINGO3

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001094861.1 Gene:LINGO3 / 645191 HGNCID:21206 Length:592 Species:Homo sapiens


Alignment Length:420 Identity:97/420 - (23%)
Similarity:159/420 - (37%) Gaps:78/420 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 WLLSLQVVLILPPSYHLATPSSGSGQLRRLWLQDHCSAGICTNVV-------------------- 50
            ||..|.:.|:|.|:   |.|.:|....|       |...:.|..|                    
Human     4 WLCVLSLPLLLLPA---APPPAGGCPAR-------CECTVQTRAVACTRRRLTAVPDGIPAETRL 58

  Fly    51 --IGRSDYVILSQAPIGGTTMLTFLNSSIAKIPHL---LFDTFPDLQVLRMENCSLETFEKPQFE 110
              :.|:....|:...:.....|..|:.|...|.|:   .|...|.|:|||:..            
Human    59 LELSRNRIRCLNPGDLAALPALEELDLSENAIAHVEPGAFANLPRLRVLRLRG------------ 111

  Fly   111 GASNLMSLFLGYNRLKDIPKNIFLGADNLATLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQ 175
                        |:||.||..:|...|||..|.|..|:|..|.:::|..|..::.|.:.:|.|..
Human   112 ------------NQLKLIPPGVFTRLDNLTLLDLSENKLVILLDYTFQDLHSLRRLEVGDNDLVF 164

  Fly   176 ISLGVFSGMRKLMDLNLAGNRLDALPRGVFDRNLNLTKLNLARNRFTAFESELLKLQPVFTQLDI 240
            :|...|:|:..|.:|.|....|.||.........:|..|.|......:.|.:..:..|....|:|
Human   165 VSRRAFAGLLALEELTLERCNLTALSGESLGHLRSLGALRLRHLAIASLEDQNFRRLPGLLHLEI 229

  Fly   241 SGNIFQELTLNFTMLDVAIAHSCDLRRLTVYGVIHELDLHNNSLREMPHIPL--AANVSSLDLSH 303
            .         |:.:|:...|.|.....||...|.|      .::..:|...|  .|:::.|:|||
Human   230 D---------NWPLLEEVAAGSLRGLNLTSLSVTH------TNITAVPAAALRHQAHLTCLNLSH 279

  Fly   304 NPLGNLQGNPLRRFTSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKAL 368
            ||:..:.....|....|..|:|:......:....|.....:::|::|.|.:.:|:.:.|.|:..|
Human   280 NPISTVPRGSFRDLVRLRELHLAGALLAVVEPQAFLGLRQIRLLNLSNNLLSTLEESTFHSVNTL 344

  Fly   369 QYFYFQQNNWNCDFLQLLMSSFVKRKDISF 398
            :......|...||...|.:..  :||.::|
Human   345 ETLRVDGNPLACDCRLLWIVQ--RRKTLNF 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 66/271 (24%)
LRR_8 91..149 CDD:290566 16/57 (28%)
leucine-rich repeat 91..114 CDD:275380 4/22 (18%)
leucine-rich repeat 115..138 CDD:275380 6/22 (27%)
LRR_8 138..197 CDD:290566 18/58 (31%)
leucine-rich repeat 139..162 CDD:275380 8/22 (36%)
leucine-rich repeat 163..186 CDD:275380 6/22 (27%)
LRR_8 185..243 CDD:290566 13/57 (23%)
leucine-rich repeat 187..210 CDD:275380 6/22 (27%)
leucine-rich repeat 211..283 CDD:275380 15/71 (21%)
leucine-rich repeat 284..319 CDD:275380 10/36 (28%)
LRR_8 318..377 CDD:290566 11/58 (19%)
leucine-rich repeat 320..343 CDD:275380 4/22 (18%)
leucine-rich repeat 344..365 CDD:275380 5/20 (25%)
LINGO3NP_001094861.1 LRRNT 24..58 CDD:214470 4/40 (10%)
LRR 1 55..76 2/20 (10%)
LRR_8 57..138 CDD:290566 25/104 (24%)
LRR_4 59..95 CDD:289563 7/35 (20%)
leucine-rich repeat 59..79 CDD:275380 2/19 (11%)
LRR 2 79..100 6/20 (30%)
leucine-rich repeat 80..103 CDD:275380 6/22 (27%)
LRR 3 103..124 10/44 (23%)
leucine-rich repeat 104..127 CDD:275380 10/46 (22%)
LRR_RI 111..>286 CDD:238064 52/213 (24%)
LRR_8 127..>172 CDD:290566 14/44 (32%)
LRR 4 127..148 8/20 (40%)
leucine-rich repeat 128..151 CDD:275380 8/22 (36%)
LRR 5 151..172 5/20 (25%)
leucine-rich repeat 152..199 CDD:275380 12/46 (26%)
LRR 6 175..196 6/20 (30%)
LRR_8 198..258 CDD:290566 15/74 (20%)
leucine-rich repeat 200..223 CDD:275380 4/22 (18%)
LRR 7 207..228 2/20 (10%)
leucine-rich repeat 224..247 CDD:275380 6/31 (19%)
LRR_8 247..303 CDD:290566 17/61 (28%)
LRR 8 247..268 6/26 (23%)
leucine-rich repeat 248..271 CDD:275380 6/28 (21%)
LRR 9 271..292 6/20 (30%)
leucine-rich repeat 272..293 CDD:275380 7/20 (35%)
LRR 10 295..316 4/20 (20%)
leucine-rich repeat 296..319 CDD:275380 4/22 (18%)
LRR 11 319..340 5/20 (25%)
leucine-rich repeat 322..343 CDD:275380 6/20 (30%)
I-set 407..497 CDD:254352
Ig 422..490 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.