DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and 2mit

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001262529.1 Gene:2mit / 41616 FlyBaseID:FBgn0260793 Length:1155 Species:Drosophila melanogaster


Alignment Length:412 Identity:106/412 - (25%)
Similarity:159/412 - (38%) Gaps:89/412 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 TFPDLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLKDIPKNIFLGADN-----LATLHLQG 146
            |..||...::|:.||:.|        :.|..|.||.|.|:.||.::   ||.     ..||.|..
  Fly   124 TAMDLSSNQLESLSLDNF--------NQLRQLDLGNNSLEVIPLSL---ADTNMSLPFVTLDLSC 177

  Fly   147 NQLKQLGNHSFHA--LKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNRLDALPRGVFDRNL 209
            |:..|:.. ||.|  |.::|.|:||.|:|..||...|..:.:|..|.|:.|.:..:....|....
  Fly   178 NKFSQIST-SFFAQRLPQLKNLNLAHNELLNISRESFYNLLELQTLVLSHNNISDIDYETFLALP 241

  Fly   210 NLTKLNLARNRFTAFESELLKLQPVFTQLDIS-----GNIFQELTLNFTM--LDVAIAHSCDLRR 267
            ||..|:|:.||.:......|:..|....|.|:     |...||...::::  ||.:....|.:..
  Fly   242 NLQYLDLSHNRLSGSAIRALQGIPDLVSLSIAYNPDVGVAMQEFVASWSLKELDASGTGLCQVPA 306

  Fly   268 LTVYGVIHELDLHNNSLR-----EMPHIPLAANVSSLDLSHNPLGNLQGNPLRRF---------- 317
            .....| ..|.|.:|.|:     :|...||   :..|||||:.:..::.:.|.|.          
  Fly   307 ALAQSV-RTLKLSDNWLKAINCGDMDSYPL---LQYLDLSHSRIAQVEDDALGRLELLESLFLDR 367

  Fly   318 -----------TSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKALQYF 371
                       .||..|.|......|||...|....:||.||:|.|.:..|.......|..|.  
  Fly   368 NLLMRVPSSLPPSLEHLFLQHNQIMELPPQAFVGLVNLQTLDLSNNRLIFLPPLSLPKLLTLN-- 430

  Fly   372 YFQQNNWNCDFLQLLMSSFVKRKDISFMEDITAPELVDDYVD----------GIACWYESDKQSK 426
                          |.||.|:....|.:.  |.|:|.|..::          |||.|....:...
  Fly   431 --------------LESSGVESVSQSIVH--TLPQLRDLLLEDNPIKCSDLLGIAEWASPCRSVD 479

  Fly   427 KCESGGSDAAMELSVVRNEIKT 448
            ..:|.|:..:     .|.::||
  Fly   480 AGQSNGASVS-----GRVDLKT 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 85/306 (28%)
LRR_8 91..149 CDD:290566 19/62 (31%)
leucine-rich repeat 91..114 CDD:275380 5/22 (23%)
leucine-rich repeat 115..138 CDD:275380 9/22 (41%)
LRR_8 138..197 CDD:290566 22/65 (34%)
leucine-rich repeat 139..162 CDD:275380 9/24 (38%)
leucine-rich repeat 163..186 CDD:275380 9/22 (41%)
LRR_8 185..243 CDD:290566 15/62 (24%)
leucine-rich repeat 187..210 CDD:275380 5/22 (23%)
leucine-rich repeat 211..283 CDD:275380 18/78 (23%)
leucine-rich repeat 284..319 CDD:275380 11/60 (18%)
LRR_8 318..377 CDD:290566 17/58 (29%)
leucine-rich repeat 320..343 CDD:275380 7/22 (32%)
leucine-rich repeat 344..365 CDD:275380 7/20 (35%)
2mitNP_001262529.1 LRR_RI 124..355 CDD:238064 69/246 (28%)
leucine-rich repeat 124..143 CDD:275380 7/26 (27%)
leucine-rich repeat 144..167 CDD:275380 10/25 (40%)
leucine-rich repeat 172..194 CDD:275380 9/22 (41%)
LRR_8 193..253 CDD:290566 19/59 (32%)
leucine-rich repeat 195..218 CDD:275380 9/22 (41%)
leucine-rich repeat 219..242 CDD:275380 5/22 (23%)
LRR_8 241..301 CDD:290566 15/59 (25%)
leucine-rich repeat 243..311 CDD:275380 15/67 (22%)
leucine-rich repeat 312..335 CDD:275380 6/23 (26%)
LRR_8 334..415 CDD:290566 23/83 (28%)
leucine-rich repeat 336..359 CDD:275380 7/22 (32%)
leucine-rich repeat 360..380 CDD:275380 0/19 (0%)
LRR_8 379..460 CDD:290566 26/98 (27%)
LRR_4 379..>415 CDD:289563 14/35 (40%)
leucine-rich repeat 381..404 CDD:275380 7/22 (32%)
leucine-rich repeat 405..449 CDD:275380 15/61 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.