DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and CG7800

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_649770.1 Gene:CG7800 / 40963 FlyBaseID:FBgn0037552 Length:533 Species:Drosophila melanogaster


Alignment Length:402 Identity:104/402 - (25%)
Similarity:160/402 - (39%) Gaps:72/402 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 LATPSSGSGQLRRLWLQDHCSAGICTNVVIGRSDYVILSQAPIGGTTMLTFLNSSIAKIPHLLFD 86
            ||:.|:    |.|..|:|:|:...|.  ::|||               .||.:....|:.....|
  Fly     9 LASVSA----LGRPDLEDYCNDSYCH--LLGRS---------------RTFSDKKATKLTEFHMD 52

  Fly    87 T--------FPDLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLKDIPKNIFLGADNLATLH 143
            :        .|:|:.|.:|||....|..........|.||.|....|..:....|....|:..|.
  Fly    53 SCEKKVLKLMPNLRTLELENCDSPDFTMNDLNQLPYLTSLQLRRGNLLGLHDEHFSKWPNMKILM 117

  Fly   144 LQGNQLKQLGNHSFHALKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNRLDALPRGVFDRN 208
            |.||.:.:|.|..|..|.::..|||..|.::.:...||..:.:|:.|:|:|||::.|...:|...
  Fly   118 LGGNNITRLSNECFKGLAQLWLLSLPGNGIQGLPWDVFQNLPELLHLDLSGNRIETLHENIFTGV 182

  Fly   209 LNLTKLNLARNRFTAFESELLKLQPVFTQLDISGNIFQELTLNFTMLDVAIAHSCDLRRLTVYGV 273
            ..|..|.|..|..|......||.......||:| |......|:.......|..:..::||.:.|.
  Fly   183 PKLEMLLLNGNPLTWIAPTSLKSLSNLRLLDMS-NCGPLPDLSLPGAHTLILDNSGVQRLDILGS 246

  Fly   274 IH---------------------ELDLHNNSL--REMPHIPLAA-NVSSLDLSHNPL------GN 308
            :|                     |||||:|.|  .::|.:.... .:..||||.|.:      |:
  Fly   247 VHKLQARKNHITEIKLPDKSSVIELDLHSNLLTATDIPKLLTGMWRLQRLDLSENIIGIYAAAGS 311

  Fly   309 LQGNPLRRFTSLLRLNLSA---TGAH---ELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKA 367
            ...:.|....:|:.:||||   |..|   .:|   :::.:|   ||.|.|.||:......|....
  Fly   312 DNTSELFILPNLMYMNLSANRLTRLHFDSPIP---WERLTH---LDASYNRIYAPAKVGIDEAFN 370

  Fly   368 LQYFYFQQNNWN 379
            ||..:.:.|..|
  Fly   371 LQSLHLEGNYIN 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 82/313 (26%)
LRR_8 91..149 CDD:290566 17/57 (30%)
leucine-rich repeat 91..114 CDD:275380 6/22 (27%)
leucine-rich repeat 115..138 CDD:275380 6/22 (27%)
LRR_8 138..197 CDD:290566 20/58 (34%)
leucine-rich repeat 139..162 CDD:275380 8/22 (36%)
leucine-rich repeat 163..186 CDD:275380 6/22 (27%)
LRR_8 185..243 CDD:290566 18/57 (32%)
leucine-rich repeat 187..210 CDD:275380 8/22 (36%)
leucine-rich repeat 211..283 CDD:275380 22/92 (24%)
leucine-rich repeat 284..319 CDD:275380 9/43 (21%)
LRR_8 318..377 CDD:290566 18/64 (28%)
leucine-rich repeat 320..343 CDD:275380 8/28 (29%)
leucine-rich repeat 344..365 CDD:275380 7/20 (35%)
CG7800NP_649770.1 leucine-rich repeat 46..64 CDD:275380 1/17 (6%)
leucine-rich repeat 65..85 CDD:275380 6/19 (32%)
LRR_8 87..147 CDD:290566 19/59 (32%)
leucine-rich repeat 89..112 CDD:275380 6/22 (27%)
leucine-rich repeat 113..136 CDD:275380 8/22 (36%)
LRR_RI <131..334 CDD:238064 53/203 (26%)
leucine-rich repeat 137..160 CDD:275380 6/22 (27%)
LRR_8 140..195 CDD:290566 18/54 (33%)
leucine-rich repeat 161..184 CDD:275380 8/22 (36%)
leucine-rich repeat 185..208 CDD:275380 7/22 (32%)
leucine-rich repeat 209..246 CDD:275380 8/37 (22%)
leucine-rich repeat 247..267 CDD:275380 1/19 (5%)
leucine-rich repeat 268..292 CDD:275380 8/23 (35%)
leucine-rich repeat 293..322 CDD:275380 7/28 (25%)
leucine-rich repeat 395..406 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.