DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and caps

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001303391.1 Gene:caps / 39493 FlyBaseID:FBgn0023095 Length:811 Species:Drosophila melanogaster


Alignment Length:421 Identity:111/421 - (26%)
Similarity:168/421 - (39%) Gaps:78/421 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VVLILPPSYHLATPSSGSGQLRRLWLQDHCSAGICTNVVIGRSDYVI-LSQAPIG-----GTTML 70
            :.:.|.|  ||       ||...|.|   |   :|..:|:......: |:..|.|     .|.|:
  Fly     7 ITMSLAP--HL-------GQAFSLCL---C---LCLCLVLATLPVALGLANCPNGCECDDDTLMV 56

  Fly    71 TFLNSSIAKIPHLLFDTFPDLQVLRMENCSLETFEKP-QFEGASNLMSLFLGYNRLKDIPKNIFL 134
            .....::..:|..|   .|.:|.|.::|..|:|.:.. ||  .:.|..|.|.:|.:..||:..|.
  Fly    57 NCGEGTLDVLPIAL---NPAIQRLVIKNNKLKTIDSSMQF--YAQLTFLDLSFNDMLTIPERSFA 116

  Fly   135 GADNLATLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNRLDA 199
            ....|..|||..|::.|:.|.:|..|..:..|:|..|.:.::....||.|.||.:|||..||:..
  Fly   117 YHAKLQELHLDHNKIGQVSNKTFLGLSTISVLNLRGNLIAELEYRTFSPMVKLAELNLGQNRISH 181

  Fly   200 LPRGVFDRNLNLTKLNLARNRFTAFESELL-----KLQPVF----TQLDISGNIFQELTLNFTML 255
            :.....|...||..|.|..|..|....||.     .|..::    :.:.|.|..||:|. ..|.|
  Fly   182 IDPHALDGLDNLRVLYLDDNTLTTVPGELTFQALHSLAELYLGTNSFMTIPGGAFQDLK-GLTRL 245

  Fly   256 DVAIAHSCDLRRLTVYGVI--HELDLHNNSLREMPHIPLAA-----NVSSLDLSHNPLGNLQGNP 313
            |:..|...::....:.|::  ..|||.:|.|   |.||.||     .:..|::..|....:... 
  Fly   246 DLRGAGLHNISGDALKGLVSLRFLDLSDNRL---PAIPTAAFQRLGRLEQLNIGQNDFEVISSG- 306

  Fly   314 LRRFTSLLRL-NLSATGAHEL---PEGLFKKQSHLQMLDISGN-----------------SIYSL 357
              .|:.|..| :|..|||..|   ..|.|...::|:.|::|.|                 |...|
  Fly   307 --AFSGLRELRHLELTGAQRLRRVESGAFSGNTNLEHLNLSSNKQLNELSSIALGGLPHLSTVVL 369

  Fly   358 KITIFDSLKA-------LQYFYFQQNNWNCD 381
            |.....||..       ||.....:|.:.||
  Fly   370 KANQLSSLDEGLVPWADLQTLDLSENPFECD 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 84/307 (27%)
LRR_8 91..149 CDD:290566 19/58 (33%)
leucine-rich repeat 91..114 CDD:275380 7/23 (30%)
leucine-rich repeat 115..138 CDD:275380 7/22 (32%)
LRR_8 138..197 CDD:290566 21/58 (36%)
leucine-rich repeat 139..162 CDD:275380 9/22 (41%)
leucine-rich repeat 163..186 CDD:275380 6/22 (27%)
LRR_8 185..243 CDD:290566 18/66 (27%)
leucine-rich repeat 187..210 CDD:275380 7/22 (32%)
leucine-rich repeat 211..283 CDD:275380 21/82 (26%)
leucine-rich repeat 284..319 CDD:275380 9/39 (23%)
LRR_8 318..377 CDD:290566 20/86 (23%)
leucine-rich repeat 320..343 CDD:275380 9/26 (35%)
leucine-rich repeat 344..365 CDD:275380 7/37 (19%)
capsNP_001303391.1 leucine-rich repeat 75..96 CDD:275380 7/22 (32%)
LRR_8 96..155 CDD:290566 19/58 (33%)
leucine-rich repeat 97..120 CDD:275380 7/22 (32%)
leucine-rich repeat 121..144 CDD:275380 9/22 (41%)
LRR_8 143..201 CDD:290566 18/57 (32%)
leucine-rich repeat 145..168 CDD:275380 6/22 (27%)
LRR_RI 147..397 CDD:238064 67/256 (26%)
leucine-rich repeat 169..192 CDD:275380 7/22 (32%)
leucine-rich repeat 193..217 CDD:275380 7/23 (30%)
LRR_8 217..276 CDD:290566 15/59 (25%)
leucine-rich repeat 218..241 CDD:275380 6/23 (26%)
leucine-rich repeat 242..265 CDD:275380 5/22 (23%)
LRR_8 265..321 CDD:290566 16/61 (26%)
leucine-rich repeat 266..289 CDD:275380 10/25 (40%)
leucine-rich repeat 290..313 CDD:275380 4/25 (16%)
LRR_8 312..374 CDD:290566 15/61 (25%)
leucine-rich repeat 314..335 CDD:275380 8/20 (40%)
leucine-rich repeat 339..363 CDD:275380 4/23 (17%)
LRRCT 395..445 CDD:214507 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.