DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and CG4168

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001285953.1 Gene:CG4168 / 34889 FlyBaseID:FBgn0028888 Length:1330 Species:Drosophila melanogaster


Alignment Length:378 Identity:103/378 - (27%)
Similarity:169/378 - (44%) Gaps:54/378 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 PIGGTTMLTFLNSSIAKIPHLLFDTFPDLQVLRMENCSLETFEKPQF--EGASNLMSLFLGYNRL 125
            |:.....|...|:::.::.:..|....:|..:.:....|:|..:..|  :..|:|:.:.|.||.|
  Fly   586 PLSQLIWLGLDNNNLKQVSNESFAQMRELSYINLSFNQLKTLPRGLFQSDAHSHLVEIDLSYNGL 650

  Fly   126 KDIPKNIFLGADNLATLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQISLGVFSGMRKLMDL 190
            :.:....|....:|.||:||.|:|:.:..|:||.|:.::.|.|:.|:|..||.|.|:.:..|..|
  Fly   651 ERLEAQTFHSLGDLQTLNLQSNRLRTIARHAFHNLEFLRYLDLSYNRLVNISHGAFTVLPNLAAL 715

  Fly   191 NLAGNRLDALPRGVFDRNLNLT---KLNLARNRFTAFESELLKLQPVFTQLDISGN------IFQ 246
            :|..|:|.:|....|....|.|   :||::.|...:|..||.....:: |||||.|      .|.
  Fly   716 DLMHNQLCSLSLKSFLYVSNTTTPLRLNVSHNHIASFYDELSSYMYIY-QLDISHNHVTKSDSFT 779

  Fly   247 EL--TLNFTMLDVAIAHS----------CDLRRLTVYGVIHELDLHNN--SLREMPHIPLAANVS 297
            .|  ||.|    :.:||:          .||..|.:..|     .|||  |||......| .::.
  Fly   780 NLANTLRF----LNLAHNQLGSLQSHAFGDLEFLEILNV-----AHNNLTSLRRRSFQGL-NSLQ 834

  Fly   298 SLDLSHNPLGNLQGNPLRRFTSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKITIF 362
            .||||||.|..||.........|..|.:::.....||..:| ..:.|:.|||:.|.:....:..|
  Fly   835 ELDLSHNQLDQLQVEQFSNLRKLRILRINSNRLRALPREVF-MNTRLEFLDIAENQLSVWPVPAF 898

  Fly   363 D----SLKALQYFYFQQNNWNCDFL--------QLLMSSFVKRKDISFMEDIT 403
            .    :|:::     |.::.|.::|        |.|....:.|..|:.:.|.|
  Fly   899 TDIGFTLRSI-----QMSHNNLEYLDASMFINSQFLYDISLARNRITILPDNT 946

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 89/294 (30%)
LRR_8 91..149 CDD:290566 17/59 (29%)
leucine-rich repeat 91..114 CDD:275380 4/24 (17%)
leucine-rich repeat 115..138 CDD:275380 6/22 (27%)
LRR_8 138..197 CDD:290566 23/58 (40%)
leucine-rich repeat 139..162 CDD:275380 11/22 (50%)
leucine-rich repeat 163..186 CDD:275380 8/22 (36%)
LRR_8 185..243 CDD:290566 20/60 (33%)
leucine-rich repeat 187..210 CDD:275380 7/22 (32%)
leucine-rich repeat 211..283 CDD:275380 27/94 (29%)
leucine-rich repeat 284..319 CDD:275380 12/34 (35%)
LRR_8 318..377 CDD:290566 13/62 (21%)
leucine-rich repeat 320..343 CDD:275380 5/22 (23%)
leucine-rich repeat 344..365 CDD:275380 6/24 (25%)
CG4168NP_001285953.1 leucine-rich repeat 99..118 CDD:275380
LRR_8 121..181 CDD:290566
LRR_RI 122..350 CDD:238064
leucine-rich repeat 122..146 CDD:275380
leucine-rich repeat 147..170 CDD:275380
leucine-rich repeat 171..194 CDD:275380
leucine-rich repeat 195..214 CDD:275380
leucine-rich repeat 215..236 CDD:275380
LRR_8 265..322 CDD:290566
leucine-rich repeat 266..287 CDD:275380
leucine-rich repeat 288..311 CDD:275380
leucine-rich repeat 312..338 CDD:275380
LRR_RI 315..546 CDD:238064
leucine-rich repeat 339..365 CDD:275380
LRR_8 365..424 CDD:290566
leucine-rich repeat 366..388 CDD:275380
leucine-rich repeat 389..412 CDD:275380
LRR_8 413..470 CDD:290566
leucine-rich repeat 414..436 CDD:275380
leucine-rich repeat 437..459 CDD:275380
leucine-rich repeat 460..483 CDD:275380
LRR_8 482..545 CDD:290566
leucine-rich repeat 484..510 CDD:275380
leucine-rich repeat 511..534 CDD:275380
leucine-rich repeat 535..589 CDD:275380 1/2 (50%)
LRR_RI 588..891 CDD:238064 91/314 (29%)
LRR_8 588..650 CDD:290566 12/61 (20%)
leucine-rich repeat 590..613 CDD:275380 3/22 (14%)
leucine-rich repeat 614..639 CDD:275380 4/24 (17%)
LRR_8 638..698 CDD:290566 21/59 (36%)
leucine-rich repeat 640..663 CDD:275380 6/22 (27%)
leucine-rich repeat 664..687 CDD:275380 11/22 (50%)
LRR_8 688..749 CDD:290566 20/60 (33%)
leucine-rich repeat 688..711 CDD:275380 8/22 (36%)
leucine-rich repeat 712..735 CDD:275380 7/22 (32%)
leucine-rich repeat 740..783 CDD:275380 14/43 (33%)
LRR_8 784..843 CDD:290566 22/68 (32%)
leucine-rich repeat 785..808 CDD:275380 6/26 (23%)
leucine-rich repeat 809..832 CDD:275380 9/28 (32%)
LRR_RI <827..1053 CDD:238064 31/127 (24%)
LRR_8 832..890 CDD:290566 19/58 (33%)
leucine-rich repeat 833..856 CDD:275380 9/22 (41%)
leucine-rich repeat 857..879 CDD:275380 5/22 (23%)
leucine-rich repeat 880..900 CDD:275380 6/19 (32%)
LRR_8 904..963 CDD:290566 10/48 (21%)
leucine-rich repeat 905..928 CDD:275380 4/27 (15%)
leucine-rich repeat 929..952 CDD:275380 5/18 (28%)
leucine-rich repeat 953..977 CDD:275380
leucine-rich repeat 978..1020 CDD:275380
LRR_8 1019..1074 CDD:290566
leucine-rich repeat 1045..1068 CDD:275380
leucine-rich repeat 1069..1090 CDD:275380
leucine-rich repeat 1091..1114 CDD:275380
leucine-rich repeat 1115..1161 CDD:275380
leucine-rich repeat 1162..1190 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.