DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and CG42346

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001036303.2 Gene:CG42346 / 3355160 FlyBaseID:FBgn0259677 Length:1817 Species:Drosophila melanogaster


Alignment Length:527 Identity:133/527 - (25%)
Similarity:221/527 - (41%) Gaps:132/527 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LWWLLSLQVVLILPPSYHLATPSSGSGQLRRLWLQDHCSAGICTNVV--IGRSDYVILSQAPIGG 66
            :.||...|:..: ..|:...||     ||.||:|.|        |.:  |.:..:|.|       
  Fly   751 IMWLKDNQLTRV-ERSFFADTP-----QLGRLYLSD--------NKIRDIEKDTFVNL------- 794

  Fly    67 TTMLTFLNSSIAKIPHLLFDTF---PDLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLKDI 128
             .:|.||:.|..::..|..|.|   .||:.|.:....:|..|...|....||.||.|.:|.|..:
  Fly   795 -LLLQFLDLSGNQLRQLRRDYFAPLQDLEELSLARNHIEAIEGYAFAKLKNLKSLDLSHNPLVQL 858

  Fly   129 PKNIFLGADNLATLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQI----------------- 176
            .::||.....|.:|:|....|::|..|:|.:|..:.||:|..|||...                 
  Fly   859 TRDIFSNEFPLNSLNLGNCSLRKLEQHAFKSLTNLNELNLERNQLNPADIQTLDIPNLRRLLLSH 923

  Fly   177 -------SLGVFSGM----RKLMDLNLAGNRLDALPRGVFDRNLNLTKLNLARNRFTAFESELLK 230
                   |:|:.:||    |.|..|:::...|..:|..:|.:|.||.:|:|..||.|...     
  Fly   924 NNFSYAGSVGIMAGMLDRLRSLQQLSMSNCSLGQIPDLLFAKNTNLVRLDLCDNRLTQIN----- 983

  Fly   231 LQPVFTQLDISGNIFQELTL---------NFTMLDVAIAHSCDLRRLTVYGV----------IHE 276
             :.:|:.|    |:|:||.|         :..:.:::...|.||.|..:..:          :.:
  Fly   984 -RNIFSGL----NVFKELRLCRNELSDFPHIALYNLSTLESLDLARNQLASIDFFKLSGTLNLRQ 1043

  Fly   277 LDLHNNSLREMPHIPLAANVS---SLDLSHNPLGNLQGNPLRRFTSLLRLNLSATGAHELPEGLF 338
            |.|.:|.:..:.... |.|::   |:|||.|.|.:|..|.||...:|.:::||.....::|....
  Fly  1044 LILRDNKITALSGFN-AVNLTQLDSVDLSGNLLLSLPANFLRHSINLQKVHLSNNRFLQIPSSAL 1107

  Fly   339 KKQS--HLQMLDISG---NSIYSLKITIFDSLKALQYFYFQQNNWNCDFLQLLMSSFVKRKDISF 398
            ...|  .|..|:::|   |.||::|...:..||.|   |..|.|     |.:|.|     ||...
  Fly  1108 SDVSIPRLSWLNLTGNPINRIYTVKEERYPYLKEL---YICQTN-----LSILTS-----KDFEA 1159

  Fly   399 MEDITAPELVDDYVDGIACWYESDKQSKKCESGGSDAA------MELSVVRNEIKTFTELVEKKF 457
            .:.:....||::.:..|              |.|:..:      ::|||  ||:    |::.|:.
  Fly  1160 FQALQHLHLVNNRITRI--------------SPGAFKSLTNLLTLDLSV--NEL----EMLPKER 1204

  Fly   458 VKVYRML 464
            ::..|:|
  Fly  1205 LQGLRLL 1211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 84/327 (26%)
LRR_8 91..149 CDD:290566 17/57 (30%)
leucine-rich repeat 91..114 CDD:275380 5/22 (23%)
leucine-rich repeat 115..138 CDD:275380 8/22 (36%)
LRR_8 138..197 CDD:290566 21/86 (24%)
leucine-rich repeat 139..162 CDD:275380 8/22 (36%)
leucine-rich repeat 163..186 CDD:275380 10/50 (20%)
LRR_8 185..243 CDD:290566 16/57 (28%)
leucine-rich repeat 187..210 CDD:275380 6/22 (27%)
leucine-rich repeat 211..283 CDD:275380 19/90 (21%)
leucine-rich repeat 284..319 CDD:275380 12/37 (32%)
LRR_8 318..377 CDD:290566 17/63 (27%)
leucine-rich repeat 320..343 CDD:275380 5/24 (21%)
leucine-rich repeat 344..365 CDD:275380 7/23 (30%)
CG42346NP_001036303.2 leucine-rich repeat 303..325 CDD:275380
LRR_8 325..384 CDD:290566
leucine-rich repeat 327..350 CDD:275380
leucine-rich repeat 351..461 CDD:275380
LRR_8 373..433 CDD:290566
LRR_RI 397..648 CDD:238064
leucine-rich repeat 399..422 CDD:275380
leucine-rich repeat 462..485 CDD:275380
LRR_8 465..520 CDD:290566
leucine-rich repeat 486..509 CDD:275380
LRR_8 508..567 CDD:290566
leucine-rich repeat 510..533 CDD:275380
LRR_RI 527..785 CDD:238064 13/47 (28%)
leucine-rich repeat 534..556 CDD:275380
LRR_8 555..613 CDD:290566
leucine-rich repeat 557..580 CDD:275380
leucine-rich repeat 581..604 CDD:275380
LRR_8 604..663 CDD:290566
leucine-rich repeat 605..628 CDD:275380
leucine-rich repeat 629..652 CDD:275380
LRR_8 652..711 CDD:290566
leucine-rich repeat 653..676 CDD:275380
leucine-rich repeat 677..700 CDD:275380
leucine-rich repeat 701..748 CDD:275380
leucine-rich repeat 725..736 CDD:275378
leucine-rich repeat 749..772 CDD:275380 6/26 (23%)
LRR_8 771..831 CDD:290566 21/80 (26%)
leucine-rich repeat 773..793 CDD:275380 7/27 (26%)
LRR_RI 804..1076 CDD:238064 71/282 (25%)
LRR_8 821..903 CDD:290566 26/81 (32%)
leucine-rich repeat 821..844 CDD:275380 5/22 (23%)
leucine-rich repeat 845..868 CDD:275380 8/22 (36%)
leucine-rich repeat 869..892 CDD:275380 8/22 (36%)
leucine-rich repeat 893..915 CDD:275380 6/21 (29%)
leucine-rich repeat 916..944 CDD:275380 4/27 (15%)
leucine-rich repeat 945..968 CDD:275380 6/22 (27%)
LRR_8 967..1027 CDD:290566 18/69 (26%)
leucine-rich repeat 969..992 CDD:275380 8/32 (25%)
leucine-rich repeat 993..1014 CDD:275380 4/20 (20%)
LRR_8 1015..1075 CDD:290566 14/60 (23%)
leucine-rich repeat 1017..1040 CDD:275380 4/22 (18%)
leucine-rich repeat 1041..1064 CDD:275380 5/23 (22%)
LRR_RI <1047..1244 CDD:238064 50/199 (25%)
LRR_8 1063..1125 CDD:290566 18/61 (30%)
leucine-rich repeat 1089..1114 CDD:275380 5/24 (21%)
leucine-rich repeat 1115..1162 CDD:275380 18/59 (31%)
LRR_8 1163..1219 CDD:290566 14/69 (20%)
leucine-rich repeat 1163..1186 CDD:275380 5/36 (14%)
leucine-rich repeat 1187..1210 CDD:275380 7/28 (25%)
leucine-rich repeat 1211..1233 CDD:275380 1/1 (100%)
leucine-rich repeat 1234..1257 CDD:275380
LRR_8 1235..1292 CDD:290566
leucine-rich repeat 1258..1279 CDD:275380
leucine-rich repeat 1282..1306 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.