DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and GP5

DIOPT Version :10

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_004479.1 Gene:GP5 / 2814 HGNCID:4443 Length:560 Species:Homo sapiens


Alignment Length:391 Identity:108/391 - (27%)
Similarity:159/391 - (40%) Gaps:71/391 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SGSGQLRRLWLQD-HCSAGICTNVVIGR-SDYVILSQAPIGGTTMLTFLNSSIAKIPHLLFDTFP 89
            ||...|:||.:.| |.||     |..|. ||.:.|.        .|....:.|..:|..|.|...
Human    71 SGMTVLQRLMISDSHISA-----VAPGTFSDLIKLK--------TLRLSRNKITHLPGALLDKMV 122

  Fly    90 DLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLKDIPKNIFLGADNLATLHLQGNQLKQLGN 154
            .|:.|.:::.:|...::..|:...||..|.|..|:|..:|.::|...:||..|.|.||.|..|..
Human   123 LLEQLFLDHNALRGIDQNMFQKLVNLQELALNQNQLDFLPASLFTNLENLKLLDLSGNNLTHLPK 187

  Fly   155 HSFHALKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNRLDALPRGVFDRNLNLTKLNLARN 219
            ....|..:::.|.|..|:|..:..|:.:.:..|.:|....|.:.::..|.|||..||:.|.|:||
Human   188 GLLGAQAKLERLLLHSNRLVSLDSGLLNSLGALTELQFHRNHIRSIAPGAFDRLPNLSSLTLSRN 252

  Fly   220 RFTAFESEL------LKLQPVFTQ--LDISGNIF------QELTLNFTML-DVAIAHSCDLRRLT 269
            ......|.|      |.|..:|..  .::.|.:|      |||.||.|.| .:..|...:|.||.
Human   253 HLAFLPSALFLHSHNLTLLTLFENPLAELPGVLFGEMGGLQELWLNRTQLRTLPAAAFRNLSRLR 317

  Fly   270 VYGV-------------------IHELDLHNNSLREMPHIPLAANVSSLDLSHNPLGNLQGNPLR 315
            ..||                   :..|.||:|.|..:|.                 |.|:|....
Human   318 YLGVTLSPRLSALPQGAFQGLGELQVLALHSNGLTALPD-----------------GLLRGLGKL 365

  Fly   316 RFTSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKALQYFYFQQNNWNC 380
            |..||.|..|.|     ||..||:..|.|:.:.:..|.:.:|...:|.:|..|.......|:|.|
Human   366 RQVSLRRNRLRA-----LPRALFRNLSSLESVQLDHNQLETLPGDVFGALPRLTEVLLGHNSWRC 425

  Fly   381 D 381
            |
Human   426 D 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 leucine-rich repeat 91..114 CDD:275380 4/22 (18%)
LRR <100..426 CDD:443914 87/316 (28%)
leucine-rich repeat 115..138 CDD:275380 7/22 (32%)
leucine-rich repeat 139..162 CDD:275380 8/22 (36%)
leucine-rich repeat 163..186 CDD:275380 5/22 (23%)
leucine-rich repeat 187..210 CDD:275380 7/22 (32%)
leucine-rich repeat 211..283 CDD:275380 28/105 (27%)
leucine-rich repeat 284..319 CDD:275380 6/34 (18%)
leucine-rich repeat 320..343 CDD:275380 8/22 (36%)
leucine-rich repeat 344..365 CDD:275380 4/20 (20%)
GP5NP_004479.1 LRR <44..>299 CDD:443914 69/240 (29%)
LRR 1 75..96 9/25 (36%)
leucine-rich repeat 76..99 CDD:275380 11/27 (41%)
LRR 2 99..120 5/28 (18%)
leucine-rich repeat 100..123 CDD:275380 6/30 (20%)
LRR 3 123..144 4/20 (20%)
leucine-rich repeat 124..147 CDD:275380 4/22 (18%)
LRR 4 147..168 8/20 (40%)
leucine-rich repeat 148..171 CDD:275380 7/22 (32%)
LRR 5 171..193 8/21 (38%)
leucine-rich repeat 172..195 CDD:275380 8/22 (36%)
LRR 6 195..216 5/20 (25%)
leucine-rich repeat 196..219 CDD:275380 5/22 (23%)
LRR 7 219..240 5/20 (25%)
leucine-rich repeat 220..243 CDD:275380 7/22 (32%)
LRR 8 243..264 8/20 (40%)
leucine-rich repeat 244..267 CDD:275380 7/22 (32%)
LRR 9 267..288 5/20 (25%)
leucine-rich repeat 268..291 CDD:275380 5/22 (23%)
LRR_8 291..351 CDD:404697 17/59 (29%)
LRR 10 291..312 8/20 (40%)
leucine-rich repeat 292..315 CDD:275380 9/22 (41%)
leucine-rich repeat 316..338 CDD:275380 3/21 (14%)
LRR_8 340..399 CDD:404697 22/80 (28%)
LRR 11 340..361 8/37 (22%)
leucine-rich repeat 341..364 CDD:275380 9/39 (23%)
LRR 12 364..385 10/25 (40%)
leucine-rich repeat 365..388 CDD:275380 10/27 (37%)
LRR 13 388..409 4/20 (20%)
leucine-rich repeat 389..410 CDD:275380 4/20 (20%)
LRRCT 421..472 CDD:214507 4/6 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 469..498
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.