DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and dma-1

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_492253.1 Gene:dma-1 / 187968 WormBaseID:WBGene00011345 Length:603 Species:Caenorhabditis elegans


Alignment Length:433 Identity:104/433 - (24%)
Similarity:174/433 - (40%) Gaps:81/433 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSLQVVLILPPSYHLATPSSGSGQLRRLWLQDHCSAGICTNVVIGRSDYVILSQAPIGGTTMLTF 72
            |:|:.:.|.|||..:     ||.:||  |           |..|.|          .....:|..
 Worm    60 LTLRSLHIQPPSNRI-----GSNKLR--W-----------NDNINR----------FAQLRVLRL 96

  Fly    73 LNSSIAKIPHLLFDTFPDLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLKDIPKNIFLGAD 137
            :|..|..:...:  ..|.|:||.:.:.::|......|.|...|..|.|..|.|..:|..:|....
 Worm    97 INCQIPAMSRSI--RLPSLEVLDLHSNNIEHATMSNFGGMPKLRVLDLSSNHLNILPTGVFTYLR 159

  Fly   138 NLATLHLQGNQLKQLGNHSFHALKEVKELSLAEN--QLEQISLGVFSGMRKLMDLNLAGNRLDAL 200
            .|.:|.|..|.:..|..:....|..::.|.|..|  .:|.|: .:|:.:.:|.:|.|....|.::
 Worm   160 ALRSLSLSNNTISDLSTNLLRGLNSLRVLRLDRNPIPIEHIN-ELFTDVSQLDELYLNHCNLSSI 223

  Fly   201 PRGVFDRNLNLTKLNLARNRFTAFESELLKLQPVFTQLDISGNIFQELT------LNFTMLDVAI 259
            .....||...|.:|.:..|......::.|:..|..:.||:|.|..||:|      .|.:.||  :
 Worm   224 YSLALDRIPQLRQLGIGGNNLKMVPTKELRSLPQLSVLDLSHNSIQEITACAFCNTNISKLD--L 286

  Fly   260 AHSCDLRRLTVYGVIHELDLHNNSLREMP--HIPLAAN----------------VSSLDLSHNPL 306
            :|:       :.|:..:...:.::.|.||  |:.|:.|                ::|:.||.|.|
 Worm   287 SHN-------LLGISKDSPFNEDAFRTMPLRHLDLSFNHMNDFDSKWLGWAQEELTSIALSGNFL 344

  Fly   307 GNLQGNPLRRFTSLLRLNLSATGAHELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKALQYF 371
            .|.:.:......||:.|.|:......:|..|..:..||..|:||||.:..|...|...|..::.|
 Worm   345 KNFEESWTYTLKSLIHLELAYNHIKFIPVQLPSRYYHLISLNISGNELTYLPDNINTLLPNVKTF 409

  Fly   372 YFQQNNWNCDFLQLLMSSFVKRKDISFMEDITAPELVDDYVDG 414
            ....|.::.          ....|::|:.::   |.|  ||||
 Worm   410 DITANRFHT----------FSHTDLAFLNNV---EQV--YVDG 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 74/295 (25%)
LRR_8 91..149 CDD:290566 17/57 (30%)
leucine-rich repeat 91..114 CDD:275380 6/22 (27%)
leucine-rich repeat 115..138 CDD:275380 7/22 (32%)
LRR_8 138..197 CDD:290566 15/60 (25%)
leucine-rich repeat 139..162 CDD:275380 6/22 (27%)
leucine-rich repeat 163..186 CDD:275380 6/24 (25%)
LRR_8 185..243 CDD:290566 14/57 (25%)
leucine-rich repeat 187..210 CDD:275380 6/22 (27%)
leucine-rich repeat 211..283 CDD:275380 17/77 (22%)
leucine-rich repeat 284..319 CDD:275380 12/52 (23%)
LRR_8 318..377 CDD:290566 17/58 (29%)
leucine-rich repeat 320..343 CDD:275380 5/22 (23%)
leucine-rich repeat 344..365 CDD:275380 8/20 (40%)
dma-1NP_492253.1 LRR_8 90..147 CDD:338972 14/58 (24%)
leucine-rich repeat 91..112 CDD:275380 3/22 (14%)
leucine-rich repeat 113..136 CDD:275380 6/22 (27%)
LRR 136..430 CDD:227223 74/313 (24%)
leucine-rich repeat 137..160 CDD:275380 7/22 (32%)
leucine-rich repeat 161..184 CDD:275380 6/22 (27%)
leucine-rich repeat 185..209 CDD:275380 6/24 (25%)
leucine-rich repeat 210..233 CDD:275380 6/22 (27%)
leucine-rich repeat 234..257 CDD:275380 4/22 (18%)
leucine-rich repeat 258..280 CDD:275380 7/21 (33%)
leucine-rich repeat 281..307 CDD:275380 5/34 (15%)
leucine-rich repeat 309..357 CDD:275380 9/47 (19%)
leucine-rich repeat 382..405 CDD:275380 9/22 (41%)
leucine-rich repeat 406..429 CDD:275380 4/32 (13%)
TPKR_C2 438..>478 CDD:387596 104/433 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.