DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and sym-1

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_510426.1 Gene:sym-1 / 181555 WormBaseID:WBGene00006366 Length:680 Species:Caenorhabditis elegans


Alignment Length:372 Identity:84/372 - (22%)
Similarity:156/372 - (41%) Gaps:64/372 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSLQVVLILPPSYHLATPSSGSGQLRRLWLQDHCSAGICTNVVIGRSDYVILSQAPIGGTTMLT 71
            ||.|.|.|::.|:.....|.....|..       ||   |.:.|.|    .::..:...|..|:.
 Worm     2 LLRLCVALLVLPACLAFCPKLFQNQTA-------CS---CDSTVEG----PVIKCSGHDGLRMVE 52

  Fly    72 FLNSSIAKIPHLLFDTFPDLQVLRMENCSLETFEKPQFEGASNLMSLFLGYNRLKDIPKNIFLGA 136
            .|:::          |..:::.|.:||..:.......|: ...:..|.|..||::.|..:.|.|.
 Worm    53 KLSTT----------TTMEVRELALENADIIEVGPKAFK-TLRIKKLILSNNRIEKIHDHAFTGL 106

  Fly   137 DN-LATLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNRLDAL 200
            :| :..|.|..|.||::...:...|:.:..|||..|::|.|:...|..|..|:|:||..|::.::
 Worm   107 ENVMQELSLSENNLKEVPTSALAGLRVLNILSLKCNKIENITTKAFVNMTSLIDVNLGCNQICSM 171

  Fly   201 PRGVF-DRNLNLTKLNLARNRFTAFESELLKLQPVFTQLDISGNIFQELTLNFTMLDVAIAHSCD 264
            ....| :..::|..|.|..|..|.|.|:.::            |:...:.|:..           
 Worm   172 AADTFANVKMSLQNLILDNNCMTEFPSKAVR------------NMNNLIALHIK----------- 213

  Fly   265 LRRLTVYGVIHELDLHNNSLREMPHIPLAANVSSLDLSHNPLGNLQGNPLRRFTSLLRLNLSATG 329
                  |..|       |::|:...:.| .::|.|.|:.|.:..::|..|:...:|..|.|:...
 Worm   214 ------YNKI-------NAIRQNDFVNL-TSLSMLSLNGNNISEIKGGALQNTPNLHYLYLNENN 264

  Fly   330 AHELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKALQYFYFQQN 376
            ...|..|:.::...||:||:|.|:...:...:|:.|:::|:.....|
 Worm   265 LQTLDNGVLEQFKQLQVLDLSFNNFTDITKEMFEGLESIQHLNLDSN 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 64/271 (24%)
LRR_8 91..149 CDD:290566 15/58 (26%)
leucine-rich repeat 91..114 CDD:275380 4/22 (18%)
leucine-rich repeat 115..138 CDD:275380 7/22 (32%)
LRR_8 138..197 CDD:290566 20/59 (34%)
leucine-rich repeat 139..162 CDD:275380 6/22 (27%)
leucine-rich repeat 163..186 CDD:275380 8/22 (36%)
LRR_8 185..243 CDD:290566 13/58 (22%)
leucine-rich repeat 187..210 CDD:275380 6/23 (26%)
leucine-rich repeat 211..283 CDD:275380 11/71 (15%)
leucine-rich repeat 284..319 CDD:275380 8/34 (24%)
LRR_8 318..377 CDD:290566 15/59 (25%)
leucine-rich repeat 320..343 CDD:275380 5/22 (23%)
leucine-rich repeat 344..365 CDD:275380 7/20 (35%)
sym-1NP_510426.1 leucine-rich repeat 62..81 CDD:275380 3/18 (17%)
LRR_5 74..208 CDD:290045 37/146 (25%)
LRR_RI 81..384 CDD:238064 63/269 (23%)
leucine-rich repeat 86..108 CDD:275380 7/21 (33%)
leucine-rich repeat 110..133 CDD:275380 6/22 (27%)
leucine-rich repeat 134..157 CDD:275380 8/22 (36%)
leucine-rich repeat 158..182 CDD:275380 6/23 (26%)
LRR_8 182..241 CDD:290566 18/95 (19%)
leucine-rich repeat 183..206 CDD:275380 8/34 (24%)
leucine-rich repeat 207..230 CDD:275380 6/47 (13%)
leucine-rich repeat 231..254 CDD:275380 6/22 (27%)
LRR_8 253..313 CDD:290566 15/59 (25%)
leucine-rich repeat 255..278 CDD:275380 5/22 (23%)
leucine-rich repeat 279..302 CDD:275380 8/22 (36%)
LRR_8 302..384 CDD:290566 2/10 (20%)
leucine-rich repeat 303..323 CDD:275380 2/9 (22%)
leucine-rich repeat 350..373 CDD:275380
leucine-rich repeat 374..394 CDD:275380
leucine-rich repeat 399..410 CDD:275378
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.