DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and LRG1

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_443204.1 Gene:LRG1 / 116844 HGNCID:29480 Length:347 Species:Homo sapiens


Alignment Length:347 Identity:91/347 - (26%)
Similarity:131/347 - (37%) Gaps:81/347 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 DLQVLRMENCSLETFEKP-QFEG--ASNLMSLFLGYNRLKDIPKNIFLGADNLATLHLQGNQLKQ 151
            |.||.|.::.|..:.:.| :..|  .::.:.|.:.:..|..:|.|:..||..|..|||..|.|:.
Human    42 DCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLES 106

  Fly   152 LGNHSFHALKEVKELSLAENQLEQISLGVFSGMRKLMDLNLAGNRLDALPRGVFDRNLNLTKLNL 216
            |   |...|:.|.:|.:                     |:|..|.|..||.|:|..:..|..|.|
Human   107 L---SPEFLRPVPQLRV---------------------LDLTRNALTGLPPGLFQASATLDTLVL 147

  Fly   217 ARNRFTAFESELLKLQPVFTQLDISGNIFQE----LTLNFTMLDVAIAHSCDLRRLTVYGVIHEL 277
            ..|:....|...|........||:|||..::    |..|||:|                   ..|
Human   148 KENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLL-------------------RTL 193

  Fly   278 DLHNNSLREMPHIPLAANVSSLDLSHNPLG----NLQGNPLRRF--------TSLLRLNLSATGA 330
            ||..|.|..:|.          ||...||.    :|:||.|:..        ..|..|.|:....
Human   194 DLGENQLETLPP----------DLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKL 248

  Fly   331 HELPEGLFKKQSHLQMLDISGNSIYSLKITIFDSLKALQY-----FYFQQNNWNCD-FLQLLMSS 389
            ..:..|.|:....|.|||:|.||:.|:...::.||....:     |....|.|.|| .|..|...
Human   249 ARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRW 313

  Fly   390 FVKRKDISFMEDIT---APELV 408
            ...:||..|.::.|   .||.|
Human   314 LQAQKDKMFSQNDTRCAGPEAV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 73/282 (26%)
LRR_8 91..149 CDD:290566 17/60 (28%)
leucine-rich repeat 91..114 CDD:275380 6/25 (24%)
leucine-rich repeat 115..138 CDD:275380 6/22 (27%)
LRR_8 138..197 CDD:290566 14/58 (24%)
leucine-rich repeat 139..162 CDD:275380 9/22 (41%)
leucine-rich repeat 163..186 CDD:275380 2/22 (9%)
LRR_8 185..243 CDD:290566 17/57 (30%)
leucine-rich repeat 187..210 CDD:275380 8/22 (36%)
leucine-rich repeat 211..283 CDD:275380 19/75 (25%)
leucine-rich repeat 284..319 CDD:275380 10/46 (22%)
LRR_8 318..377 CDD:290566 16/63 (25%)
leucine-rich repeat 320..343 CDD:275380 5/22 (23%)
leucine-rich repeat 344..365 CDD:275380 8/20 (40%)
LRG1NP_443204.1 LRR_8 79..128 CDD:290566 19/72 (26%)
LRR_RI <82..248 CDD:238064 56/218 (26%)
LRR 1 93..114 9/23 (39%)
leucine-rich repeat 94..117 CDD:275380 10/25 (40%)
LRR_8 116..176 CDD:290566 20/80 (25%)
LRR 2 117..138 9/41 (22%)
leucine-rich repeat 118..141 CDD:275380 9/43 (21%)
LRR 3 141..162 6/20 (30%)
leucine-rich repeat 142..165 CDD:275380 6/22 (27%)
LRR 4 165..186 6/20 (30%)
leucine-rich repeat 166..189 CDD:275380 8/22 (36%)
LRR_8 169..224 CDD:290566 23/83 (28%)
LRR 5 189..210 9/49 (18%)
leucine-rich repeat 190..213 CDD:275380 10/51 (20%)
LRR_8 213..272 CDD:290566 15/58 (26%)
LRR 6 213..234 4/20 (20%)
leucine-rich repeat 214..237 CDD:275380 4/22 (18%)
LRR 7 237..258 5/20 (25%)
leucine-rich repeat 238..261 CDD:275380 5/22 (23%)
LRR 8 261..282 8/20 (40%)
leucine-rich repeat 262..285 CDD:275380 10/22 (45%)
LRRCT 299..346 CDD:214507 13/37 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45617
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.