DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment alrm and AT1G33612

DIOPT Version :9

Sequence 1:NP_651393.1 Gene:alrm / 43074 FlyBaseID:FBgn0039332 Length:471 Species:Drosophila melanogaster
Sequence 2:NP_001185131.1 Gene:AT1G33612 / 10723140 AraportID:AT1G33612 Length:455 Species:Arabidopsis thaliana


Alignment Length:423 Identity:99/423 - (23%)
Similarity:155/423 - (36%) Gaps:101/423 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSLQVVLILPPSYHLATPSSGSGQLRRLWLQDHC--SAGICTN-------VVIGRSDYVILSQA 62
            ||..:..:...||..|::...|:         |.|  |...|.|       .|.|  |:.:...:
plant    36 LLGFKSGITKDPSGILSSWKKGT---------DCCFWSGVFCVNNDRVTQLSVDG--DFSLDGNS 89

  Fly    63 PIGGTT------------MLTFLNSSIAKIPHLLFDTFPDLQVLRMENCSLETFEKPQFEGASNL 115
            |.|..:            :||.|.......|..:| ..|.|..:.::.|.|...........|.|
plant    90 PSGTISPMLAKLQHLERILLTSLRKITGPFPQFIF-RLPKLNYINIQGCLLSGPLPANIGELSQL 153

  Fly   116 MSLFLGYNRLK-DIPKNIFLGADNLATLHLQGNQLKQLGNHSFHALKEVKELSLAENQLEQISLG 179
            .:|.:..|... .||.:| .....|..|:|..|:|.....:.|.::||:..|.|:.|       |
plant   154 KTLVIDGNMFTGHIPSSI-ANLTRLTWLNLGNNRLSGTIPNIFKSMKELNSLDLSRN-------G 210

  Fly   180 VFSGMRK----------LMDL---NLAG------NRLDALPRGVFDRN-------------LNLT 212
            .|..:..          .:||   ||:|      :|.:||...|..:|             :|:|
plant   211 FFGRLPPSIASLAPTLYYLDLSQNNLSGTIPNYLSRFEALSTLVLSKNKYSGVVPMSFTNLINIT 275

  Fly   213 KLNLARNRFTAFESELLKLQPVFTQLDISGNIFQELTLNFTMLDVAIAHSCDLRRLTVYGVIHEL 277
            .|:|:.|..|. ...:||.......||:|.|.|...|:...|:.....:|..|.:.   |:...|
plant   276 NLDLSHNLLTG-PFPVLKSINGIESLDLSYNKFHLKTIPKWMISSPSIYSLKLAKC---GLKISL 336

  Fly   278 DLHNNSLREMPHIPLAAN--VSSLDLSHNPLGNLQGNPLRRFTSLLR--LNLSATG---AHELPE 335
            |          ...||..  ..|:|||.|   .:.|:| .:|.|.::  :...|.|   ..:|.:
plant   337 D----------DWKLAGTYYYDSIDLSEN---EISGSP-AKFLSQMKYLMEFRAAGNKLRFDLGK 387

  Fly   336 GLFKKQSHLQMLDISGNSIYSLKITIFDSLKAL 368
            ..|.:.  |:.||:|.|.|:...:..|..||.:
plant   388 LTFVRT--LETLDLSRNLIFGRVLATFAGLKTM 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
alrmNP_651393.1 LRR_RI 84..354 CDD:238064 75/309 (24%)
LRR_8 91..149 CDD:290566 14/58 (24%)
leucine-rich repeat 91..114 CDD:275380 3/22 (14%)
leucine-rich repeat 115..138 CDD:275380 6/23 (26%)
LRR_8 138..197 CDD:290566 18/77 (23%)
leucine-rich repeat 139..162 CDD:275380 6/22 (27%)
leucine-rich repeat 163..186 CDD:275380 5/22 (23%)
LRR_8 185..243 CDD:290566 21/89 (24%)
leucine-rich repeat 187..210 CDD:275380 10/44 (23%)
leucine-rich repeat 211..283 CDD:275380 19/71 (27%)
leucine-rich repeat 284..319 CDD:275380 10/36 (28%)
LRR_8 318..377 CDD:290566 14/56 (25%)
leucine-rich repeat 320..343 CDD:275380 4/27 (15%)
leucine-rich repeat 344..365 CDD:275380 7/20 (35%)
AT1G33612NP_001185131.1 LRRNT_2 29..68 CDD:285463 9/40 (23%)
leucine-rich repeat 84..103 CDD:275380 2/18 (11%)
LRR_RI 121..404 CDD:238064 75/311 (24%)
LRR_8 151..211 CDD:290566 18/67 (27%)
leucine-rich repeat 153..176 CDD:275380 6/23 (26%)
leucine-rich repeat 177..200 CDD:275380 6/22 (27%)
leucine-rich repeat 201..225 CDD:275380 5/30 (17%)
LRR_8 224..284 CDD:290566 15/59 (25%)
leucine-rich repeat 226..249 CDD:275380 6/22 (27%)
leucine-rich repeat 250..273 CDD:275380 3/22 (14%)
leucine-rich repeat 274..296 CDD:275380 7/22 (32%)
leucine-rich repeat 297..324 CDD:275380 7/26 (27%)
leucine-rich repeat 325..370 CDD:275380 15/61 (25%)
leucine-rich repeat 394..414 CDD:275380 7/19 (37%)
leucine-rich repeat 415..441 CDD:275380 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.