DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tobi and GANAB

DIOPT Version :9

Sequence 1:NP_651391.1 Gene:tobi / 43072 FlyBaseID:FBgn0261575 Length:657 Species:Drosophila melanogaster
Sequence 2:NP_938149.2 Gene:GANAB / 23193 HGNCID:4138 Length:966 Species:Homo sapiens


Alignment Length:687 Identity:159/687 - (23%)
Similarity:246/687 - (35%) Gaps:159/687 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RRGDKLQYELMKGEKSLQTVTFDNFDSSANLVETSSGSYQLTDGQSTVEFTLVKSGVVAGTGSEI 105
            |.|||.:....|.||.......:.|       :|.|.|.........::|:|.....|.|...  
Human   228 RDGDKPEETQGKAEKDEPGAWEETF-------KTHSDSKPYGPMSVGLDFSLPGMEHVYGIPE-- 283

  Fly   106 THVKVSRDQVLQGTQPRDCVPLKTGSTHWFSGPEQKQHYWPVERQRHSNYSYLPKEL-----DNF 165
             |....|.:|.:|.:|.....|..         .|.:.|.|:     :.|..:|..|     .:.
Human   284 -HADNLRLKVTEGGEPYRLYNLDV---------FQYELYNPM-----ALYGSVPVLLAHNPHRDL 333

  Fly   166 GVGERYWLNGDGVFLYVESNT---PLF---ID--QNSAAYPDQLCLSAISALPYDPRVTSAKFVY 222
            |:   :|||....::.:.|||   .||   :|  |.|...|..           |.|..|...:.
Human   334 GI---FWLNAAETWVDISSNTAGKTLFGKMMDYLQGSGETPQT-----------DVRWMSETGII 384

  Fly   223 HVAVAKDAKAA---HRYAVKTFLGQPT-------GYPDERMVMHPVWSTWALYKAEVSDDVVRDF 277
            .|.:......:   .:||..|  |...       ||...|      |:    |:.|.  ||:.  
Human   385 DVFLLLGPSISDVFRQYASLT--GTQALPPLFSLGYHQSR------WN----YRDEA--DVLE-- 433

  Fly   278 AKQILDNGFNNSQLEIDDDWEDCYGA-----MTFRKNKFPDSKTLTDDLKALGFRVTLWIHPFIN 337
                :|.||::..|..|..|.|...|     .|:..::||..:|:.:.|.:...::...:.|.|.
Human   434 ----VDQGFDDHNLPCDVIWLDIEHADGKRYFTWDPSRFPQPRTMLERLASKRRKLVAIVDPHIK 494

  Fly   338 -NNCTAIYDEAKSKGYLVLDHEGSSDTQW-WNSKPKDAAILDFTKTEVQEWFSKRLKRLQDEDGI 400
             ::...:::|.::.|..|...:||....| |   |..|...|||...::.|::            
Human   495 VDSGYRVHEELRNLGLYVKTRDGSDYEGWCW---PGSAGYPDFTNPTMRAWWA------------ 544

  Fly   401 DSFKFDAGETS------WLPSDPVLQASSSMVTPLQ---------------AVGDYVRTVAAFGD 444
            :.|.:|..|.|      |...:.....:...||.|:               ..|.||....|.| 
Human   545 NMFSYDNYEGSAPNLFVWNDMNEPSVFNGPEVTMLKDAQHYGGWEHRDVHNIYGLYVHMATADG- 608

  Fly   445 MVEVRSAQNTQDQP-IFVRIV-------------DKDSEWGWNNGLLTLISSMLQMNLNGYPFVL 495
               :|......::| :..|..             |..:||   :.|...|...|.:.|.|..|..
Human   609 ---LRQRSGGMERPFVLARAFFAGSQRFGAVWTGDNTAEW---DHLKISIPMCLSLGLVGLSFCG 667

  Fly   496 PDMIGGNGYYEKPPTKELFLRWLQANVFMPALQFSF-------VPWNFDDEAIAISKNFTALHAT 553
            .| :||   :.|.|..||.:||.|...:.|..:...       .||....:...|.::......:
Human   668 AD-VGG---FFKNPEPELLVRWYQMGAYQPFFRAHAHLDTGRREPWLLPSQHNDIIRDALGQRYS 728

  Fly   554 YTPYIMKLFKRAVDSGEPVNVPLWWIAPTDEVAQSIYDEFLLGEDIIAAPVVVEGATKRDIYLP- 617
            ..|:...|..:|...|.||..|||...|.|....:|.|::|||:.::..||...||....:||| 
Human   729 LLPFWYTLLYQAHREGIPVMRPLWVQYPQDVTTFNIDDQYLLGDALLVHPVSDSGAHGVQVYLPG 793

  Fly   618 EGE-WQDGNSDQVYTGPTWVMDYAAPLDTLPYFLRVG 653
            :|| |.|..|.|.:.||. .:.....|.::|.|.|.|
Human   794 QGEVWYDIQSYQKHHGPQ-TLYLPVTLSSIPVFQRGG 829

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tobiNP_651391.1 Glyco_hydro_31 246..653 CDD:279404 110/464 (24%)
GH31_NET37 255..621 CDD:269878 97/416 (23%)
GANABNP_938149.2 GH31_N 266..406 CDD:270212 36/172 (21%)
GH31_GANC_GANAB_alpha 406..873 CDD:269889 112/469 (24%)
DUF5110 849..918 CDD:319156
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1501
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.