DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10669 and che-1

DIOPT Version :9

Sequence 1:NP_001163728.1 Gene:CG10669 / 43069 FlyBaseID:FBgn0039329 Length:933 Species:Drosophila melanogaster
Sequence 2:NP_001076598.1 Gene:che-1 / 183847 WormBaseID:WBGene00000483 Length:273 Species:Caenorhabditis elegans


Alignment Length:159 Identity:45/159 - (28%)
Similarity:73/159 - (45%) Gaps:24/159 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   790 AQHLSTQHSKQ------------PA--VPEQQP-----PLRRKRRFRYQCPHCWRSFVVQPSLDK 835
            :.|::|...:|            |:  :|:::|     |:.|.....::|..|.::|....:|..
 Worm   119 SNHITTDSFRQIPPSGLCYMDPTPSLRLPKKEPLPVQRPMARSTPKPFRCQTCGKAFSQAANLTA 183

  Fly   836 HIRDMHVAKKNPGKKYLCSLCGLESLTPNKLNIHMRRHTGEKPFKCDLCDMRFTVHYELKVHRRK 900
            |.| :|..:    |.::|.:|.......:.|..|.|.||||:|:.|..|:..||....|..|.|.
 Worm   184 HKR-IHTGE----KPFMCPVCNRPFSQSSSLVTHRRTHTGERPYPCAQCEKAFTDSSTLTKHLRT 243

  Fly   901 HTGERPYQCTFCDKDFARPDKLRRHVFMH 929
            |||.:||.|:.|...|.:...|.||:..|
 Worm   244 HTGHKPYVCSICMMKFTQSGNLHRHMKTH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10669NP_001163728.1 zf-AD 4..81 CDD:285071
C2H2 Zn finger 178..199 CDD:275368
C2H2 Zn finger 216..233 CDD:275368
C2H2 Zn finger 520..542 CDD:275368
C2H2 Zn finger 550..570 CDD:275368
C2H2 Zn finger 579..600 CDD:275368
C2H2 Zn finger 610..630 CDD:275368
C2H2 Zn finger 716..737 CDD:275368
C2H2 Zn finger 746..766 CDD:275368
C2H2 Zn finger 776..795 CDD:275368 1/4 (25%)
C2H2 Zn finger 820..838 CDD:275368 5/17 (29%)
C2H2 Zn finger 853..873 CDD:275368 5/19 (26%)
zf-H2C2_2 866..889 CDD:290200 10/22 (45%)
COG5048 877..>930 CDD:227381 20/53 (38%)
C2H2 Zn finger 881..901 CDD:275368 7/19 (37%)
zf-H2C2_2 893..918 CDD:290200 11/24 (46%)
C2H2 Zn finger 909..929 CDD:275368 6/19 (32%)
che-1NP_001076598.1 zf-C2H2 166..188 CDD:278523 6/22 (27%)
C2H2 Zn finger 168..188 CDD:275368 6/20 (30%)
zf-H2C2_2 180..205 CDD:290200 7/29 (24%)
C2H2 Zn finger 196..216 CDD:275368 5/19 (26%)
zf-H2C2_2 208..232 CDD:290200 10/23 (43%)
C2H2 Zn finger 224..244 CDD:275368 7/19 (37%)
zf-H2C2_2 237..261 CDD:290200 11/23 (48%)
C2H2 Zn finger 252..272 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.