DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and pkdc

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:XP_001335286.1 Gene:pkdc / 797003 ZFINID:ZDB-GENE-041111-115 Length:322 Species:Danio rerio


Alignment Length:323 Identity:65/323 - (20%)
Similarity:120/323 - (37%) Gaps:96/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 IIKFVPTSAISKGENYLTI------VLRIQIEMQLKDNSIEDVSYILKIPLVPEDEKND------ 81
            ::|.....::..|....|:      ::|:.:|      ..:..|.::|..:.|:::|:.      
Zfish     9 VLKECGAKSLQIGAKIQTLWSGYGEIIRVHLE------GCDRPSVVVKHVMFPQNQKHPGGWNTD 67

  Fly    82 -FHEMFDAELDMYDHLIPELEDLYAKNTSISPKFK-PVHL--KFPGEPVKSDYILLEDLRKKGYR 142
             .|:   .::..|     ::|..:.:|.:.:...: |:.|  |..||   ...|:||||...|: 
Zfish    68 ISHQ---RKVRSY-----QVETYWYQNYTTNENCRVPLCLAAKSFGE---EQLIVLEDLDVAGF- 120

  Fly   143 NADRTQGLEQFEVEAVLKKLAQWHA----ASAKRVVELGEYEKDIRESYFTTEHQKLLDEFNINF 203
             ..|...:...|::|.|..:|.:||    .:.:.:..:|.|                        
Zfish   121 -PVRKTYVNDAEIKACLSWIANFHALFLDVTPEGLWPIGTY------------------------ 160

  Fly   204 CMPFLECMQQYNLE--PGQLVLISDYTSQLTDLNIEFGKNDPLELSVLN--------HGDFWCNN 258
                      ::||  |.:|..:||     ..|....|:.|    |:||        |||....|
Zfish   161 ----------WHLETRPEELEAMSD-----QKLKAAAGEID----SILNNCRFKTIVHGDAKLAN 206

  Fly   259 FMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYYHQQLVEHL 321
            |.|. |:..:|..   ||||....|...:|::..|.:.........|....::||..:|.:.|
Zfish   207 FCFS-KDGLQVAS---VDFQYVGGGCGMKDVIYFLGSCMDERECEKKAPGLLDYYFSELRKSL 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 64/312 (21%)
pkdcXP_001335286.1 PKc_like <96..267 CDD:304357 52/222 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589374
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.