DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG31370

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_733095.2 Gene:CG31370 / 43060 FlyBaseID:FBgn0051370 Length:396 Species:Drosophila melanogaster


Alignment Length:429 Identity:99/429 - (23%)
Similarity:169/429 - (39%) Gaps:64/429 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDQ-PTPQWVTKELFSSLL-----EQSNRNFKAIIKFVPTSAISKGENYLTIVLRIQIEMQLKD 59
            :.|| ..|:|:.::..:.:|     |...|..|  :.|.|.||  ||:||.::::|.::| .:..
  Fly     6 LADQLNVPEWLNEQFVTDVLRSHEKEPDLRVTK--LDFTPGSA--KGDNYASVIIRARVE-YITQ 65

  Fly    60 NSIEDVSYILKIPLVPEDEKNDFHEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPGE 124
            ......|.|:|..|    |......:|..|:.||..::||...:..:|...|..:... :.:..|
  Fly    66 KGFFSKSLIIKTVL----EMFAGSALFKTEIGMYRKVLPEFARILRENNDTSRLYAEC-IYYSLE 125

  Fly   125 PVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFT 189
            |  |..::.|||.:..|... |.:.|...|:.....|||::||.|.|.:.|..|:.|        
  Fly   126 P--SQVMIFEDLGEMDYAMV-RDRVLTHGEICGAYSKLAKFHALSMKIINERPEFVK-------- 179

  Fly   190 TEHQKLLDEFNINFCM---PFLEC-MQQYNLEPGQLVLISDYTS-----------QLTDLNIEFG 239
                    ||....|:   |::.. |..:....|::..:..|.:           :|.|:..|:.
  Fly   180 --------EFKDGICLVDIPYMSSGMGPFKDFLGRIPELDRYKTHFEKIEVHFIDRLRDIMKEYQ 236

  Fly   240 KNDPLELSVLNHGDFWCNNFMFKY-KNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKL 303
            .|......||.|||:...|.|.|: |.:...||...:|:|.......|.||:..:........::
  Fly   237 TNPQPGYYVLCHGDYHTRNIMVKHNKESGGFEDCMLLDYQGCYVAPLAFDLMYSIYMLMNREQRI 301

  Fly   304 DKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHI 368
            .:.:..:.||...|.|.|..:.|....|....|...::|...:.|:.....||:           
  Fly   302 GELETLLNYYFSVLRETLRKIGYQGKLPDPPAFWKEMYRLKDYEFLFLSTYLPM----------- 355

  Fly   369 GNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGY 407
              .:|.|.|....:.....|..::::.|.||......||
  Fly   356 --SVGLSLETATNEETDDKLQDFIEECKSILARFERSGY 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 71/301 (24%)
CG31370NP_733095.2 EcKinase 47..324 CDD:281023 71/301 (24%)
APH <202..320 CDD:279908 26/117 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459830
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.