DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG13659

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_651378.1 Gene:CG13659 / 43059 FlyBaseID:FBgn0039319 Length:417 Species:Drosophila melanogaster


Alignment Length:437 Identity:111/437 - (25%)
Similarity:194/437 - (44%) Gaps:73/437 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLLE--QSNRNFKAI-IKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIEDVSYI 68
            |:|:..:..:.:|.  :.:.|.|.| :.|.|.||  ||::|.:|:.|.::|...::.:... |.|
  Fly    14 PEWLNVQFMTQVLRGYEKDSNLKVINLSFTPASA--KGDHYASIMFRARVEYTAQNGNFTK-SLI 75

  Fly    69 LKIPLVPEDEKNDFHE---MFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPGEPVK--- 127
            :|..:|.|..|.|..:   :|..|:.||..::||.|.:               |:...:|.|   
  Fly    76 IKTMIVEEGIKKDMFKDSPLFTTEIGMYTKVLPEWERI---------------LRRANDPAKLYV 125

  Fly   128 ---------SDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDI 183
                     ...::.:||.:.||. ..|.:.|.:.|:.:...|||:.||.|.|.:.|..||.|:.
  Fly   126 ECIYHSLQPHQILIFDDLVEMGYA-VVRDRFLTREEISSAYSKLAKIHAISMKFIHEQPEYLKEF 189

  Fly   184 RESYFTTEHQKLLDEFNINFCM-PFLECMQQYNLEPGQLVLISDYTSQLTDLNIEFG-------- 239
            :..  ..|...|:|...|:..| ||:|.:       |::..:|.|......:::.|.        
  Fly   190 KNG--LCEMPGLIDSSIISGGMDPFMEML-------GRIPELSKYQPHFKKISLHFKDRLRETMQ 245

  Fly   240 --KNDPLE-LSVLNHGDFWCNNFMFK-YKNASEVEDVCFVDFQLPKYGTPAQDLL--CILMTSPK 298
              :|:|.. .:||.|.||...|.||| .|.....||...:|:|.......|.||:  ..::..| 
  Fly   246 EYRNNPQPGYNVLCHADFHSRNMMFKNNKETGCFEDCMLLDYQGCNVAPMAVDLMYSIYMLMGP- 309

  Fly   299 FSIKLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPD 363
             :.:.::.|..:.||...|:|.|..:.|..:.||...|.|.:.|:..:.|:.....||:.:   .
  Fly   310 -AQRREELDILLNYYLSILLETLKKIGYQGSMPTEQGFWAEMKRHRYYEFLLLSTFLPVSI---G 370

  Fly   364 VDSH---IGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGY 407
            :.:|   ||::|.|.|.    ::|::.|..::::.|.||......||
  Fly   371 LRTHKLDIGDMMHNEET----RKKLYQLEDFMEETKSILDRFQKSGY 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 79/315 (25%)
CG13659NP_651378.1 EcKinase 48..336 CDD:281023 79/315 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459829
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.