DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG31098

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_733091.1 Gene:CG31098 / 43057 FlyBaseID:FBgn0051098 Length:417 Species:Drosophila melanogaster


Alignment Length:415 Identity:97/415 - (23%)
Similarity:174/415 - (41%) Gaps:57/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLLEQSNRNFK----AIIKFVPTSAI--SKGENYLTIVLRIQIEMQLKDNSIEDV 65
            |:|:|.|....:|::   :||    |:.:.:..||.  .:...:.:.:.|....:|.........
  Fly    11 PEWLTAEFLQDVLKE---HFKEEQLAVTELIVKSAQVGDQAAGFASEMHRASFNLQRGTAPKGKF 72

  Fly    66 SYILKIPLVPEDEKNDF---HEMFDAELDMYDHLIPELEDL---YAKNTSISPKFKPVHLKFPGE 124
            |.|:|..  |:.:....   .::|..|:..|..::|.::.|   ....|.|:|..  .:.....|
  Fly    73 SVIVKDH--PKGQTGAVAHRSKLFKREILAYKEVLPRIQALLQSIGDQTKIAPTC--YYTTESPE 133

  Fly   125 PVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASA------KRVVELGEYEKDI 183
            |    :::|||::..|:.|.:|.:.|....|...::|:|:.||.||      ..|:|..: |..|
  Fly   134 P----FLILEDMQLSGFENFERGRLLNLDYVLPTIEKVAKLHACSALIAQDSPEVLEFFD-EAPI 193

  Fly   184 RESYFTTEHQKLLDEFNINFCMPFLECMQQYNLEPGQLVLISDYTSQLTDL--NI---------E 237
            ..:   .:.:..|..|.:|     :.|:.:   |........:.|.::.:|  |:         .
  Fly   194 SRN---PDRRDFLTFFPVN-----IRCVAE---EVAHWKGYEEITEKMFNLAENVLQRALTMFES 247

  Fly   238 FGKNDPLELSVLNHGDFWCNNFMFKYKN-ASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSI 301
            .||    :..|.|..|.|.||.:|...| ..|.:||..:||||...|:|..||...|..|...::
  Fly   248 TGK----DFRVFNLTDLWINNLLFHINNETKEPDDVVTLDFQLAYVGSPTIDLNYFLYGSLNENV 308

  Fly   302 KLDKFDYFIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDS 366
            :...:.|.:..|.:.|.:.|..|||..:.|||.:.|..|.:.||...|.|..:.|::........
  Fly   309 RKVHYKYIVREYQRVLQQTLEKLNYQGHIPTLKEIHIELIKTSLMGVIGATCLTPLIFREGAGFE 373

  Fly   367 HIGNVMGNSEEAIAFKRKMFLLPAY 391
            ::.::...:|....|:|:....|.|
  Fly   374 NLEDLNSRTESGDRFRRENVENPKY 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 70/309 (23%)
CG31098NP_733091.1 EcKinase 50..333 CDD:281023 70/306 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.