DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG11893

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_651375.1 Gene:CG11893 / 43056 FlyBaseID:FBgn0039316 Length:416 Species:Drosophila melanogaster


Alignment Length:429 Identity:103/429 - (24%)
Similarity:174/429 - (40%) Gaps:62/429 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLLEQSNRNFKAI-------IKFVPTSAISKGENYLTIVLRIQIEMQLKDNSIED 64
            |.|:..:..:.:|    |.::..       :|..|.||  :|::|.:::.|...|........  
  Fly    18 PAWLNAQFITDVL----RTYEKCPELEVTDLKITPASA--QGDHYASVMFRTTAEYTTSKGKF-- 74

  Fly    65 VSYILKIPLVPEDE--KNDF---HEMFDAELDMYDHLIPELEDLYAKNTSISPKFKP--VHLKFP 122
             ...|.|..:||.|  |.|.   ..:|..|::.|...:||.|.:..:....:..|.|  .|...|
  Fly    75 -CKPLIIKTMPEQEGHKKDMLSDSHLFSTEINAYTKALPEFERILREAGDDTKLFVPCIYHSLEP 138

  Fly   123 GEPVKSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESY 187
            .:     .::.|||..:|| ...|.:.:...|.:.|..|||:|||.|.|.:.|..:..||.:  |
  Fly   139 RQ-----VLIFEDLVPQGY-FVIRDRPINMNEYKNVFSKLAKWHAVSMKVLNEQPDILKDFK--Y 195

  Fly   188 FTTEHQKLLDEFNINFCMP-FLECMQQY----NLEPGQLVLISDYTSQLTDLNIEFGKNDPLE-L 246
            ...|...::.:..:...|. ||:.|.|.    ..:|....:..:|..::.|:..|:.||...: .
  Fly   196 GLMEMPSIMSDPMVTTGMDNFLKMMDQIPELTKYKPHFEKIKENYIQRMGDVMQEYRKNVQSDGY 260

  Fly   247 SVLNHGDFWCNNFMFKYKNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKL-----DKF 306
            .|:.||||...|.||. ||    |:|.|||||:..        ||.:.....:|:.:     .::
  Fly   261 YVMCHGDFHGRNMMFN-KN----EEVMFVDFQICN--------LCPITIDLSYSVYMLMEPEQRW 312

  Fly   307 DY---FIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHI 368
            |.   .|.:|...|.:.|..:.|....||.......:||:..:.|.......|:::........|
  Fly   313 DLGKDLINFYFSVLEDTLKKVGYKGKMPTNDGLWKQIHRHKFYDFFLLTTFSPMIVAVKANTFKI 377

  Fly   369 GNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGY 407
            ..::.:.|    .::|.:|...||..:|.:|......||
  Fly   378 HELIQDPE----IRQKSYLYDPYVQDVKKLLGKYEEMGY 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 78/306 (25%)
CG11893NP_651375.1 EcKinase 52..335 CDD:281023 78/306 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459826
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.