DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG13658

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_651374.2 Gene:CG13658 / 43055 FlyBaseID:FBgn0039315 Length:422 Species:Drosophila melanogaster


Alignment Length:435 Identity:112/435 - (25%)
Similarity:179/435 - (41%) Gaps:64/435 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLL---EQSNRNFKAIIKFVPTSAISKGENYLTIVLR-IQIEMQLKDNSIEDVSY 67
            |.|:..||....|   |:........:|..|  |..:|::|.:::.| :......|.|    .|.
  Fly    18 PAWLNAELIEGALRAYEKDPELHVTDLKISP--ATLQGDHYASVMFRAVSHYSTAKGN----FSK 76

  Fly    68 ILKIPLVPEDE--KNDF---HEMFDAELDMYDHLIPELEDLYAKNTSISPKFKP--VHLKFPGEP 125
            .|.:..:||.|  |.|.   ..:|..|:.||...:||||.:..:....:..:.|  .|...|.: 
  Fly    77 ALIVKTMPEQEGHKKDMLSNSPIFKTEILMYSKALPELERILREAGDTTKLYAPCIYHSLEPHQ- 140

  Fly   126 VKSDYILLEDLRKKGYR-NADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFT 189
                .::.|||..:||. ..||....|  |::....|||:|||||.|.:.|..::.|:.:  |..
  Fly   141 ----VMIFEDLVPQGYTVIRDRYPNKE--ELQKAFFKLAKWHAASMKVLNERPDFLKEFK--YGL 197

  Fly   190 TEHQKLLDEFNINFCMP-FLECMQQY----NLEPGQLVLISDYTSQLTDLNIEFGKN-DPLELSV 248
            ......|::..:...:| |||.:.:.    ..:|....:..:|..|::.:..|:..| .|....|
  Fly   198 WGMPNFLNDSIVTTGVPCFLEMLDKVPELTKYKPYFEKIKDNYIQQMSAVMEEYRTNPKPNRYYV 262

  Fly   249 LNHGDFWCNNFMFKY-KNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKL-----DKFD 307
            |.||||...|.||:| |.....|||..||||:..        :|.|.....:||.:     |::|
  Fly   263 LCHGDFHGRNMMFRYNKETGSFEDVMLVDFQISN--------VCPLSIDLIYSIFMVMDTEDRWD 319

  Fly   308 Y---FIEYYHQQLVEHLTMLNYNRNAPTLSKFHAHLHRYSLWAFICAQRMLPIVLLP-----PDV 364
            .   :|.||...|.:.|..:.:....||.:....|:|.:..:.|......||:|...     ..:
  Fly   320 LGKEYINYYFSVLADTLKKIGFKGEMPTQTGVWEHIHGHKDYEFFMMTSFLPLVAAMNTKTFKSM 384

  Fly   365 DSHIGNVMGNSEEAIAFKRKMFLLPAYVDQIKVILPWLINRGYIR 409
            ||....         ..|:|.|.|..|:..:|::|......||.:
  Fly   385 DSFFDP---------QTKQKSFFLDEYITDVKMLLRKFEELGYFK 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 84/309 (27%)
CG13658NP_651374.2 EcKinase 52..341 CDD:281023 84/309 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459827
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.