DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CHKov2 and CG10514

DIOPT Version :9

Sequence 1:NP_651387.1 Gene:CHKov2 / 43068 FlyBaseID:FBgn0039328 Length:409 Species:Drosophila melanogaster
Sequence 2:NP_651371.1 Gene:CG10514 / 43052 FlyBaseID:FBgn0039312 Length:413 Species:Drosophila melanogaster


Alignment Length:421 Identity:104/421 - (24%)
Similarity:197/421 - (46%) Gaps:37/421 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PQWVTKELFSSLLEQSNR-NFK----AIIKFVPTSAISKGENYLTIVLRIQIEMQL--KDNSIED 64
            |:|:|.|    .:|.:.| ::|    .|.:.....|:..||||..::.|.::|..|  |:.::::
  Fly     5 PEWLTHE----YIEHALRCHYKDEGLTITQLQINPALGPGENYGGVLTRARVEFTLSNKEKNVQN 65

  Fly    65 VSYILKIPLVPEDEKNDF---HEMFDAELDMYDHLIPELEDLYAKNTSISPKFKPVHLKFPGEPV 126
            :  |:|..:..::...:.   :::::.|:.:|..::|:..:| ......:.:..|..:....|.:
  Fly    66 L--IVKTEIDDDELTQELMAPYDIYNREMTIYQEVLPKCREL-LNEIGDTERIFPTAIYVDRERM 127

  Fly   127 KSDYILLEDLRKKGYRNADRTQGLEQFEVEAVLKKLAQWHAASAKRVVELGEYEKDIRESYFTTE 191
            .   |:.|||...||..|||.:.|.:.....:|:|||::|||:|    .|.|.:....|||....
  Fly   128 A---IIFEDLSVVGYVMADRVRRLNEEHTHLILRKLAKFHAATA----VLNERQSGCLESYDRGF 185

  Fly   192 HQKLLDEFNINFCMPFLECMQQYNLEPGQLVLISDYTSQL-------TDLNIEFGKNDPLELSVL 249
            ..:..:.::..|....|...:..:..|    .::.|..:|       .|:..|.....|.:::||
  Fly   186 FNRYTNAYSGYFVGGLLAAARWMSKVP----TLAHYGEKLFALAPHYMDIGRECFAPTPGQVNVL 246

  Fly   250 NHGDFWCNNFMFKY-KNASEVEDVCFVDFQLPKYGTPAQDLLCILMTSPKFSIKLDKFDYFIEYY 313
            .|||.|.||.|||| .|.....||..:|||...:|:|..||..:..||.|..::.|:.:...::|
  Fly   247 AHGDVWTNNVMFKYDPNTGRPVDVLLIDFQYSFWGSPCIDLHHLFNTSLKEPLRRDQQNGLFQFY 311

  Fly   314 HQQLVEHLTMLNYNRN-APTLSKFHAHLHRYSLWAFICAQRMLPIVLLPPDVDSHIGNVMGNSEE 377
            |:...|.|..|||.:| .|:|.:|...:.:...:|......:.|:::.....|:....:|.:.|.
  Fly   312 HKIFTETLEKLNYRQNQIPSLHQFKLEVEQKRFFALHSTVVVQPVMISQDPTDACFNALMNDDER 376

  Fly   378 AIAFKRKMFLLPAYVDQIKVILPWLINRGYI 408
            .|.||.:::..|.....:..::|:...:|.:
  Fly   377 GIRFKNRLYNNPTVQQNLHSLVPFFDRKGLL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CHKov2NP_651387.1 EcKinase 40..326 CDD:281023 78/298 (26%)
CG10514NP_651371.1 EcKinase 39..324 CDD:281023 78/298 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459453
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25766
OrthoDB 1 1.010 - - D343262at33208
OrthoFinder 1 1.000 - - FOG0000277
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11012
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.